Conserved Protein Domain Family
UPF0506

?
pfam11703: UPF0506 (this model, PSSM-Id:152139 is obsolete and has been replaced by 314548)
UPF0506
This uncharacterized family is found in Schistosoma genomes. Although uncharacterized it appears to belong to the knottin fold. The sequence is composed of two repeats of a 6 cysteine motif.
Statistics
?
PSSM-Id: 152139
View PSSM: pfam11703
Aligned: 11 rows
Threshold Bit Score: 69.8484
Threshold Setting Gi: 74768579
Created: 15-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 74774665   82 CRSKGQYCSRTYFHRCCGNLVCQLHGfFNGTCVDCLAERKFCIWSSECCSGRCRLFRCR 140
gi 74773452   26 CKELGQSCRRTVFDRCCGNATCQLQG-LKGKCVSCLNIGHLCWRNEQCCSQRCHRLRCR 83
gi 160358750  82 CRTEGQYCSRTYFHRCCGNLVCQLHGfFNGTCVQCLAERKFCIWSSECCSKRCRLFRCR 140
gi 74774659   82 CRTEGQYCSRTYFHRCCGNLVCQLHGfFNGTCVQCLAERKFCIWSSECCSKRCRLFRCR 140
gi 122059589  93 CKSEGQYCSRTIFHRCCGNLVCQLHGfFNGTCVQCLAERKFCIWSSECCSKRCRLFRCR 151
gi 74773886   82 CKSEGQYCSRTIFHRCCGNLVCQLHGfFNGTCVQCLAERKFCIWSSECCSKRCRLFRCR 140
gi 74773787   82 CKSEGQYCSRTYFHRCCGNLVCQLHGfFNGTCVQCLAERKFCIWSSECCSRRCRLFRCR 140
gi 74768213   25 CREIGEVCSKTVFDKCCGNTVCKLRGpFYGECVECLNSGERCWRNSECCSGYCRWFTCQ 83
gi 74768210   25 CRSIGEKCSKTVFDRCCGDSICHLTSpFHGKCVKCLKEGQLCTSDKNCCSDKCNWGKCT 83
gi 74768236   26 CRKLNEDCSKTVFSPCCDPLSCALSTaFNGKCKACLAGGYFCWRSDECCSGTCSWLKCT 84
gi 74768579   27 CRELGEECVTRGPKSCCEPLICGLKShGTGVCVKCIPGGSECKKSEDCCSKRCKSGYCK 85
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap