2QVT


Conserved Protein Domain Family
AvrL567-A

?
pfam11529: AvrL567-A 
Click on image for an interactive view with Cn3D
Melampsora lini avirulence protein AvrL567-A
AvrL567-A is a protein from the fungal pathogen flax which induces plant disease resistance in flax plants. The protein has a novel fold.
Statistics
?
PSSM-Id: 151966
View PSSM: pfam11529
Aligned: 3 rows
Threshold Bit Score: 281.564
Threshold Setting Gi: 159795373
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QVT_A        24 MEDVPAELTGVSEGYTRFYRSPTASVTLSGLVNVKWDNEQMTMPLFKWIGGEQAEELHFCVHIAHSIGPKLNLARTLGTV 103
gi 74627859   24 MEHVPAELTGVSEGYTRFYRSSTASVILSGLVKVKWDNEQMTMPLFKWIGGEQAEELHFDVHIAHSSGRRLDRARTLGAV 103
gi 121772391  24 MEDVPAELTGVSEGYTRFYRSPTATVTLSRLVDVKWDNEQMTMPLFKWTGGEQAEELHFCVHIAHSSGRRLNSARTLGTV 103
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
2QVT_A       104 NSNMDQHWAQAHRHSGATRRTIQDFHLFANDIPNFPDYIKIKLVPKT 150
gi 74627859  104 NSNMDQHWVEAYRSSGVTRCTIQDCHLFENDIPNFPDYIKIKLVPKT 150
gi 121772391 104 NSNMDQHWVEAYRSSGVTRCTIQDCHLFANDIPDFPDYIKIKLVPKT 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap