Conserved Protein Domain Family
EF-hand_like

?
pfam09279: EF-hand_like (this model, PSSM-Id:150071 is obsolete and has been replaced by 312695)
Click on image for an interactive view with Cn3D
Phosphoinositide-specific phospholipase C, efhand-like
Members of this family are predominantly found in phosphoinositide-specific phospholipase C. They adopt a structure consisting of a core of four alpha helices, in an EF like fold, and are required for functioning of the enzyme.
Statistics
?
PSSM-Id: 150071
View PSSM: pfam09279
Aligned: 63 rows
Threshold Bit Score: 63.3614
Threshold Setting Gi: 75295006
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam09279 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1DJW_B         81 EIDRAFEEAAGSAETLSVERLVTFLQHQQREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGNAFSLAHR 160
gi 121947010  216 DLYLLLLSYSDKKDHLTVEELAQFLKVEQKMNNVtTDYCLDIIKKFEVSEENKVKNVLGIEGFTNFMRSPACDIFNPLHH 295
gi 82273900    30 DLFLLMMAYSDRKDHLTAEELANFLHNEQKMTNVTPEYVAEIIQKFEVADENKQKGVMGIEGFTNFMRSPACDIFNPLHN 109
gi 82257887   229 DLYLIMISYSNQKEVMDLHDLAHFLENEQKMRGLTKEHLADIVAKFEPCPENLQHMVLGIDGFTNFMRSPAGDIFNPEHN 308
gi 160331887  243 DLYLLMLTYSNHKDHLDAASLQRFLQVEQKMAGVTLESCQDIIEQFEPCPENKSKGLLGIDGFTNYTRSPAGDIFNPEHH 322
gi 82273984    87 DLYLLMLTYSNPKDHLDADDLARFLNTEQKMTKVTRDHCLEIITKFEPCTDNQKQGLLGIDGFTNYMRSPAGDIFNPDHY 166
gi 148880117  344 EIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHK 423
gi 82262122   236 EIYFLFVQFSSNKEFLDTKDLMIFLEAEQGMADVSEDVSLEVIRKHEPSKEGQLKGWLSLDGFTNYLLAPECHIFDPEHK 315
gi 82262063   236 EIFFLLMQFSSNKEYLDSKDLMLFVEVEQGVEGVTEDMCRDIVQKFEPSAEGRERSYLSIDGFTHYLLSSECHIFDPQHK 315
gi 226694170  315 EVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHItEDICLDIIRRYELSEEGRQKGFLAIDGFTQYLLSSECDIFDPEQK 394

                  ...
1DJW_B        161 RVY 163
gi 121947010  296 EVY 298
gi 82273900   110 EVN 112
gi 82257887   309 EVN 311
gi 160331887  323 HVH 325
gi 82273984   167 SVN 169
gi 148880117  424 KVC 426
gi 82262122   316 RVC 318
gi 82262063   316 RVC 318
gi 226694170  395 KVA 397
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap