Conserved Protein Domain Family
CLCA_N

?
pfam08434: CLCA_N 
Calcium-activated chloride channel
The CLCA family of calcium-activated chloride channels has been identified in many epithelial and endothelial cell types as well as in smooth muscle cells and has four or five putative transmembrane regions. Additionally to their role as chloride channels some CLCA proteins function as adhesion molecules and may also have roles as tumor suppressors. The domain described here is found at the N-terminus of CLCAs.
Statistics
?
PSSM-Id: 149481
View PSSM: pfam08434
Aligned: 13 rows
Threshold Bit Score: 471.895
Threshold Setting Gi: 81895975
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam08434 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81881572    1 MESLKSPVF-LLILHLLEGVlSESL------IQLNNNGYEGIVIAIDHDVPEDEALIQHIKDMVTQASPYLFEATGKRFY 73
gi 311033467   1 MGPFKSSVF-ILILHLLEGAlSNSL------IQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLLEATGKRFY 73
gi 205831469   1 MGLFRGFVF-LLVLCLLHQS-NTSF------IKLNNNGFEDIVIVIDPSVPEDEKIIEQIEDMVTTASTYLFEATEKRFF 72
gi 81892746    1 MAFSRGPVFlLLLLYLLWGS-DTSL------IRLNENGYEDIIIAIDPAVPEDTTIIEHIKGMVTKASTYLFEATEKRFF 73
gi 122144040   1 MGLFRSFVF-LLMLYLLQGS-NTSL------VRLNNNGYEGIIIAIDPAVPEDETLIEKIQNMVIDASTYLFEATEKRFF 72
gi 74721541    1 MVFSLKVIL-FLSLLLSPVL-KSSL------VTLNNNGYDGIVIAINPSVPEDEKLIQNIKEMVTEASTHLFHATKQRAY 72
gi 81867481    1 MVPGLQVLL-FLTLHLLQNT-ESSM------VHLNSNGYEGVVIAINPSVPEDERLIPSIKEMVTQASTYLFEATERRFY 72
gi 123785733   1 MVPVLKVLL-FLTLHLLQDT-KSFK------VHLNNNGYEGVVIAINPSVPEDERLIPSLKEMVTQASTYLFEASQGRFY 72
gi 82178617    5 CLFVIFFTL-ILTFHLFCAS-STSM------VKLQNGGYEDLVFAINPGLRENVKIIDNIQNMITEASQYLFSATKNRVY 76
gi 189082520   7 AGPICNLKF-VTLLVALSSE-LPFLga---gVQLQDNGYNGLLIAINPQVPENQNLISNIKEMITEASFYLFNATKRRVF 81
gi 81895975    7 TGPVIGLKLvTLLFTL-----SPELlflgagLKLKENGYDGLLVAINPRVPEDLKLITNIKEMITEASFYLFNATKRRVF 81
gi 122140376   1 MGSFKNSVF-ILVLHLLEGAlSDSL------IQLNNNGYEGIVIAIDPNVPEDETLIQHIKDMVTDASPYLFEATEKRFY 73
gi 75051712    1 MGSFRSSLF-ILVLHLLEGAqSNSL------IQLNGNGYEGIVIAIDPNVPEDERLIQNIKDMVTKASPYLFEATEKRFY 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81881572   74 FKNVAILIPESWKAKPEYTRPKLETFKNADVLVSTTSPLGNDEPYTEHIGACGEKGIRIHLTPDFLAGKKL-TQYGPQDR 152
gi 311033467  74 FKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKL-AEYGPQGR 152
gi 205831469  73 FKNVSILIPENWKENPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQFTECGEKGEYIHFTPDLLLGKKQ-NEYGPPGK 151
gi 81892746   74 FKNVSILIPESWKDSPQYRRPKQESYKHADIKVAPPTVEGRDEPYTRQFTQCEEKAEYIHFTPDFVLGRKQ-DEYGDSGK 152
gi 122144040  73 FKNVSILIPENWKSITQYKRPKHESYKHADVRVAPPTLPGRDEPYTKQFTACEEKGEYIHFTPDFVLGNKQ-NEFGPSGR 151
gi 74721541   73 FRNVSILIPMTYKSKSEYLIPKQETYDQADVIVADLYLKYGDDPYTLQYGQCGDKGQYIHFTPNFLLTNNL-ATYGPRGK 151
gi 81867481   73 FRNVSILVPITWKSKTEYLTPKQESYDQADVIVADPHLQHGDDPYTLQYGQCGDRGQYIHFTPNFLLTDNL-GIYGPRGR 151
gi 123785733  73 FRNVSILVPMTWKSKSEYLMPKRESYDKADVIVANSHLKYGDNPYTLQYGQCGDRGRYIHFTPNFLLTDNV-RNYGPRGR 151
gi 82178617   77 IRNAKILIPMAW-SNNKYTKARTETYDKADVIIASSHVKFGDDPYTLQYGRCGEPGKYIHMTPDFLLNDSLiSTYGPRGR 155
gi 189082520  82 FRNIKILIPATWKAN-NNSKIKQESYEKANVIVTDWYGAHGDDPYTLQYRGCGKEGKYIHFTPNFLLNDNLtAGYGSRGR 160
gi 81895975   82 FRNVQILVPATWTDH-NYSRVRQESYDKANVIVAEQSEEHGDDPYTLQHRGCGQEGRYIHFTPSFLLNDELaAGYGARGR 160
gi 122140376  74 FKNVAILIPENWKTKPEYVKPKLETYKNADVLVAEPNPTGNDGPYTEQMGGCGEKGDRIYLTPDFLAGKKS-RQYGPQGR 152
gi 75051712   74 FKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKV-LQYGPQGR 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81881572  153 TFVHEWAHFRWGVFNEYNNDEKFYLS-KGKPQAVRCSAAITGKNQVRRCQGGSCITnGKCVIDRVTGLYKDNCVFVPDPH 231
gi 311033467 153 AFVHEWAHLRWGVFDEYNNDEKFYLS-NGRIQAVRCSAGITGTNVVKKCQGGSCYT-KRCTFNKVTGLYEKGCEFVLQSR 230
gi 205831469 152 LFVHEWAHLRWGVFDEYNEDQPFYRAkSKKIEATRCSAGISGRNRVYKCQGGSCLS-RACRIDSTTKLYGKDCQFFPDKV 230
gi 81892746  153 VLVHEWAHLRWGVFDEYNEDQPFYSAsSKKIEATRCSTGITGTNRVYACQGGSCAM-RRCRTNSTTKLYEKDCQFFPDKV 231
gi 122144040 152 LLVHEWAHLRWGVFDEYNDDEPFYRAkSRKIEATRCSTSITGLNRVYMCEGGSCVTnRECRIDSKTKLYEKNCQFFPDKD 231
gi 74721541  152 VFVHGWAHLRWGVFDEYNVDQPFYISrRNTTEATRCSTRITVYMVLNECKGASCIA-RPFRRDSQTGLYEAKCTFIPKRS 230
gi 81867481  152 VFVHEWAHLRWGVFDEYNMDRPFYMSrKNTVEATRCSTDITGTSVVRECQGGSCVS-RRCRRDAKTGMQEAKCTFIPNKS 230
gi 123785733 152 VFVHEWAHLRWGVFDEYNEDRPFYISgKNTIEVTRCSTDIKGSKAVHERQRGSDVT-RLCRWDSRTGLYEPKCKFFPDKI 230
gi 82178617  156 AFVHEWAHLRWGVFDEYNYEKPFYIAgNKNIEATRCSADIIGTH-IKQCQGKTC----KCARDPQTGLYEDGCVFVPDKN 230
gi 189082520 161 VFVHEWAHLRWGVFDEYNNDKPFYINgQNQIKVTRCSSDITG---IFVCEKGPCPQ-ENCII---SKLFKEGCTFIYNST 233
gi 81895975  161 VFVHEWAHLRWGVFDEYNNDKPFYVNgRNEIQVTRCSSDITG---VFVCEKGLCPH-EDCII---SKIFREGCTFLYNST 233
gi 122140376 153 AFVHEWAHLRWGVFNEYNNDQKFYLS-NKRRKPVVCSEGFTGETVIQKCQGGSCVT-QPCKLDRKTGLYEEGCEFIPHKD 230
gi 75051712  153 VFVHEWAHLRWGVFNEYNNEQKFYLS-NKKEQPVICSAAIRGTNVLPQCQGGSCVT-KPCRADRVTGLFQKECEFIPDPQ 230
                        250       260       270
                 ....*....|....*....|....*....|..
gi 81881572  232 QNEKASIMFNQNINSVVEFCTEKNHNQEAPND 263
gi 311033467 231 QTEKASIMFAQHVDSIVEFCTEQNHNKEAPNK 262
gi 205831469 231 QTEKASIMFMQSIDSVVEFCNEKTHNQEAPSL 262
gi 81892746  232 QSEKASIMFMQSIDSVTEFCKKENHNREAPTL 263
gi 122144040 232 QTEKTSIMFMQGIDSVTEFCNEKSHNQEAPTL 263
gi 74721541  231 QTAKESIVFMQNLDSVTEFCTEKTHNKEAPNL 262
gi 81867481  231 QTARGSIMFMQSLDSVVEFCTEKTHNVEAPNL 262
gi 123785733 231 QTARASIMFMQNLNSVVEFCTEKTHNTEAPNL 262
gi 82178617  231 QVPKASIMYLQALQSVTEFC-DKNHNTEAPTL 261
gi 189082520 234 QNATASIMFMQSLSSVVEFCNASTHNQEAPNL 265
gi 81895975  234 QNATGSIMFMPSLPSVVEFCNESTHNQEAPNL 265
gi 122140376 231 QREKASIMYSQSIDTVVEFCTEKNHNREAPNE 262
gi 75051712  231 QSEKASIMFAQSIDTVVEFCKEKNHNKEAPND 262
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap