1H9E


Conserved Protein Domain Family
Thymopoietin

?
pfam08198: Thymopoietin (this model, PSSM-Id:149323 is obsolete and has been replaced by 400486)
Click on image for an interactive view with Cn3D
Thymopoietin protein
Short protein of 49 amino acid isolated from bovine spleen cells. Thymopoietins (TMPOs) are a group of ubiquitously expressed nuclear proteins. They are suggested to play an important role in nuclear envelope organisation and cell cycle control.
Statistics
?
PSSM-Id: 149323
Aligned: 7 rows
Threshold Bit Score: 80.9861
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1H9E_A   1 PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR 49  human
Q4RSF1   2 AEFLEDPSVLTKDKLKNELVANNVPLPSGEHKKEVYVQLYLKNLTVQNS 50  spotted green pufferfish
Q503J3   2 AQFHEDPALLTKEKLKSELMANNVALPSADSKKDVYVQLYLKNLTVLNK 50  zebrafish
Q4S5S9   1 MPLLEDPARLSKSRLKSDLLAHNMALPPANSRKEVYVELHLKHIEQRNA 49  spotted green pufferfish
Q6DHI6   2 PVFVEDPAQFSKERLKSELIAHNVALPPPESKKHAYVELYLKHVKTNST 50  zebrafish
Q7ZTV0   2 SEFLEDPSVLTKDKLKSALLANNVALPNGDQRKDVYVQLYLKNLTVQNK 50  zebrafish
Q4SRH7   2 PEYLDDPSVLTKDKLKSELLAHNVELPSGNPPKDVFVQLYLKELTSQNV 50  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap