Conserved Protein Domain Family
IgG_binding_B

?
pfam01378: IgG_binding_B 
Click on image for an interactive view with Cn3D
B domain
This domain is found as a tandem repeat in Streptococcal cell surface proteins, such as the IgG binding protein G.
Statistics
?
PSSM-Id: 144825
View PSSM: pfam01378
Aligned: 4 rows
Threshold Bit Score: 78.1622
Threshold Setting Gi: 1064973
Created: 13-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam01378 is a member of the superfamily cl03188.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
1IGC_A        7 TYKLVINGKTLKGETTTKAVDAETAEK-AFKQYANDNGVDGVWTYDDATKTFTVTE 61
gi 75430423 300 TYRLVIKGVTFSGETATKAVDAATAEQ-AFRQYANDNGVTGEWAYDAATKTFTVTE 354
gi 75530480 364 TYKLIVKGNTFSGETTTKAIDAATAEK-EFKQYATANNVDGEWSYDDATKTFTVTE 418
gi 75504692 238 TYKLILNGKTLKGETTTEAVDAATARSfNFPILENSSSVPGDPLESTCRHASFAQA 293
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap