Conserved Protein Domain Family
Ribosomal_L15e

?
pfam00827: Ribosomal_L15e (this model, PSSM-Id:144426 is obsolete and has been replaced by 307117)
Click on image for an interactive view with Cn3D
Ribosomal L15
Statistics
?
PSSM-Id: 144426
View PSSM: pfam00827
Aligned: 58 rows
Threshold Bit Score: 237.065
Threshold Setting Gi: 76363357
Created: 28-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
pfam00827 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4A1A_L         2 GAYKYLEELWRKKQSDLMSFILRLRTWEYRQLPVIHKASRSSRPDKARKLGYKNKDGYAIWRVRVRRGGRKRPVSKGIVy 81
gi 238686934   2 SMYNYVKEAWKVPANSYVKELQWSRMQDWRKEPSVIRVERPTRIDRARNLGYKAKQGIVVVRVSVRRGGLRKPRPKHSK- 80
gi 166232726   2 SMYKHVKEAWKKPSESYVKGLQWARMQDWRKEPTVVRVEKPTRIDRARSLGYKAKQGVIVARVAVRRGGLRKPRPKHSK- 80
1VQN_M         3 SAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGR- 81
gi 254799109   4 SFYSHIKEAWRSPKEGKLAELQWQRKQEWRDEGAIERIERPTRLDKARELGYKAKQGVVVARVSVRKGGSRKQRHKAGR- 82
gi 121692398   4 SFYSHIKEAWKQPGDGKLAELQWQRKQEWRDQGAIVRIDRPTRLDKARELGYKAKQGVIIARVAVRKGGARKKRFTSGR- 82
gi 121695642   4 SFYSHIREAWKTPKEGKLAELQWQRQQEWRDQGAIERIERPTRLDKARSLGYKAKQGVVVARVSVRKGTARKQRFKAGR- 82
gi 56404824    2 GLYQYVRALYKDPKE-FLGELYKQRIQQWRREPPIVEVERPTRIDRARALGYKPLPGIKIVRVRVRKGTRKREEIKGGR- 79
gi 23822018    5 SMYKYQREAWKRPKDSYVGELLKERLPKWRKGPSVQRIKRPTRIERARRLGYRAKPGYVVVRVRVPKGGRRKSRPKKGR- 83
gi 23822019    2 GMYKYIREAWKSPKKSYVGELLKQRMIKWRREPVVVRIERPTRLDRARALGYQAKQGYVIVRVRVRKGGRKRPRWKGGR- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4A1A_L        82 gKPSSVGINQLKF-ARNLRSCAEERVGKRVPELRVLNSYWVGQDGTYKFYEVILADPSHNAIRNDPRINWICESAHKHRE 160
gi 238686934  81 -KPSTLGINKITM-AKSIQRIAEERAAKKYPNLEVLNSYWVGQDGKQKWYEVILVDSCHPSIKSDKSYNWLCKGTHKGRA 158
gi 166232726  81 -KPATMAMNKITM-SKSIQRIAEERAAKRYPNLEVLNSYSVGEDGKRKWYEVILIDVNHPSIKNDSSYKNLCTGKHTNRV 158
1VQN_M        82 -RSKRQGVTRITR-RKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV 159
gi 254799109  83 -RSKRQGVNRLSR-RKSIQRISEERASRKYRNLRVLNSYWVGEDGSQKWHEVILVDPNHPAIENDGDLGWIASDDHKGRA 160
gi 121692398  83 -RSKRQGVNRLGR-RTSIQRIAEERAARKYPNLRTLASYWVGEDGSQKWHEIILIDPEHAAIENDDDLNWICDDTHKGRA 160
gi 121695642  83 -RSKRQGVNKITR-RKNLQRIAEERSGRKFRNLRVLNSYWVGEDGSQKWFEVILLDPEHGAIQNDDDLSWICDDSQRGRA 160
gi 56404824   80 -RPK--AEYRIRPlGVNLQWIAEERANRLHRNMEVLGSYWVGEDGLYKWYEVILVDPFNPNIYNRPEYVWLLQKNQRGRV 156
gi 23822018   84 -RPKRMGKNKFSP-GKSKQWIAEERAQRKYPNLEVLNSYWVGEDGQYKYYEVIMVDPYHPQIKSDHRINWICQKSQKGRV 161
gi 23822019   81 -KPSKMGQVKYSP-KKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWIALKHHKGRV 158
                        170       180       190
                 ....*....|....*....|....*....|....
4A1A_L       161 LRGLTSAGRKGRGLrVKGHRAKSLRTSRKGN-WR 193
gi 238686934 159 TRGLTSAGKKGRGLmYKGKGAEKVRPSVRAN-SK 191
gi 166232726 159 FRGLTSAGKKGRGLmNKGKGAEKVRPGIRAN-KK 191
1VQN_M       160 FRGLTGAGRRNRGLsGKGKGSEKTRPSLRSN-GG 192
gi 254799109 161 FRGLTSAGTKGRGQrTRGTGTEKTRPSVTGN-DR 193
gi 121692398 161 FRGLTNAGRSNRGLqNRGKGAEHTRPSAGSG-SR 193
gi 121695642 161 YRGRTSAGQRGRGQqKRGKGTEHTRPSIRAN-DK 193
gi 56404824  157 FRGKTSSARKFRGLrNGGLGAEKVRPSKRAN-FK 189
gi 23822018  162 FRGKTGAGKKARGLrKRGKGAEKVRPSLRAH-RR 194
gi 23822019  159 FRGLTSAGKKGRGLrNKGKGAEKVRPSIRANeGK 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap