Conserved Protein Domain Family
SAA

?
pfam00277: SAA (this model, PSSM-Id:144022 is obsolete and has been replaced by 306732)
Serum amyloid A protein
Statistics
?
PSSM-Id: 144022
View PSSM: pfam00277
Aligned: 19 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914950     1 WFSFIREAYQGAEDMWRAYSDMKEANWRDSDKYFHARGNYDAAKRGPGGVWAAEVISDAREGIQSLM--------GRGHE 72
gi 122138722  21 WYSFFKEAVQGASDLWRAYWDMRDANVQNSGRYFRARGNYEAAQRGPGGVWAAKIISNVGEYLQGFLyqiy-lgdSYGLE 99
gi 296452894  21 WRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIdcylfgnsSTVLE 100
gi 82265197   20 WYKFPGQAVRGSHDMYRAYRDMRKANWKNSDKYFHARGNYDAAQRGPGGRWAAKVISDAREWAQQKT--------GRGAS 91
gi 82121476   22 WHRYPGQAIGGAKDMWRAYRDMRKANWKGADKYFHARGNYDAARRGPGGRWAAKVISNGREALQGLS--------RRGNS 93
gi 82198043   20 WYRFPGEAAGGAKDMWRAYQHMKEANWKNSDKYFHARGNYEAAQRGPGGYWAAKVISDGREALQGLI--------RRGNS 91
gi 74817607   25 AADRVREAAQGARDMHRAYSDMREANWKNSDKYFHARGNYDAANRGPGGRWAAEVISNAREGYQSRLs-------GQGEA 97
gi 123911014  25 GGRFVLDAAGGAWDTLRAYRDMREANHVGADKYFHARGNYDAARRGPGGAWAARVISDARENWQSGVs-------GRGAE 97
gi 82213584   27 STDFIRDAVQGSQDMWDAYSVMREANYKGSDKYFHARGNRDAAQRGPGGAWAAKVISDARETWQSDVt-------GRGAE 99
gi 1743392    13 WYRFPGEAAQGAKDMWRAYGDMKDANWKNSDKYFHARGNYDAARRGPGGRWAATVISNGREMIQG-Sn-------GRGHE 84
                         90       100       110
                 ....*....|....*....|....*....|
gi 3914950    73 DSMADQEANRWGRSGNDPNHYRPAGLPDKY 102
gi 122138722 100 DQVSNRRAEEWGRSGQDPDHFRPAGLPKKY 129
gi 296452894 101 DSKSNEKAEEWGRSGKDPDRFRPDGLPKKY 130
gi 82265197   92 DSAADQAANRWGRNGGNPNVYRPRGLPRRY 121
gi 82121476   94 DAAADQAANRWGRNGGNPNRYRPRGLPKKY 123
gi 82198043   92 DAAADQEANLWGRNGGDPNKYRPKGLPIKY 121
gi 74817607   98 DTRADQEANEWGRNGGDPNRYRPEGLPDRY 127
gi 123911014  98 DTRADQEANAWGRNGGDPNRYRPPGLPSKY 127
gi 82213584  100 DTRADQEANEWGRSGGDLNRYRPTGLPQKY 129
gi 1743392    85 DSAADQKANHWGRNGGDPNRFRPQGLPKNY 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap