Conserved Protein Domain Family
HN_L-whirlin_R1_like

?
cd07356: HN_L-whirlin_R1_like (this model, PSSM-Id:143617 is obsolete and has been replaced by 259822)
First harmonin_N_like domain (repeat 1) of the long isoform of whirlin, and related domains.
This subgroup contains the first of two harmonin_N_like domains of the long isoform of whirlin, and related domains. Whirlin is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein which binds various components of the Usher protein network of the inner ear and the retina: erythrocyte protein p55, usherin, VlGR1, and myosin XVa. The long isoform of whirlin contains two harmonin_N_like domains, and three PDZ protein-binding domains, PDZ1-3. This first harmonin_N_like domain precedes PDZ1, and is a putative protein-binding module based on its sequence similarity to the N-terminal domain of harmonin. This first harmonin_N_like domain has been assayed for interaction with the cytoplasmic domain of cadherin 23 (a component of the Usher network and an interacting partner of the harmonin N-domain), however no interaction could be detected. The short whirlin isoform, derived from an alternative start ATG, lacks this first harmonin_N_like domain. The short isoform has in common with the long isoform, the second harmonin_N_like domain (designated repeat 2, not present in this subgroup), and PDZ3.
Statistics
?
PSSM-Id: 143617
View PSSM: cd07356
Aligned: 7 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 8-Apr-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Hierarchy
?
Display:
 
putative
Feature 1:putative protein binding pocket
Evidence:
  • Comment:based on the binding of the N-terminal domain of harmonin to an internal peptide of cadherin 23.

cd07356 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd07347:harmonin_N_likecd07353:harmonin_Ncd07354:HN_L-delphilin-R1_likecd07355:HN_L-delphilin-R2_likecd07356:HN_L-whirlin_R1_likecd07357:HN_L-whirlin_R2_likecd07358:HN_PDZD7_like1984244601563933825640497522407331612289090421949984211573477819842446015639338256404975224073316122890904219499842115734778
cd07356 Sequence Cluster
cd07356 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd07356 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
Feature 1         ## ##  ##           ##  #  ## ##  #                           ####            
gi 56404975    35 LSANVRQLHQALTALLSEAEREQFTHCLNAYHARRNVFDLVRTLRVLLDSPVKRRLLPMLRLVIPRSDQLLFDQYTAE 112
gi 219499842   14 LSSNVRRLHDHLNVSLDEAERQEFVQALNDYHYKRNVYDLVYNLRILLDTPEKRQLFSLLRKVIPKSDQALFDMHTSE 91
gi 122890904   16 LSVNVKKLHNALNVLLNDFEREQFIHCLNVYHAKRNVFDLVQTLKVILNTPHKRQLLPMLRLVIPRSDQLLFDQYTSE 93
gi 156393382   11 ISESVRHLHNTLTKILSDQERAYFIQSLNRYQRNRDVDSLVASLKTVLNSPKKRQVFPILREIIPSRDRHYFDKTWQG 88
gi 224073316   31 LSANVRRLHQVLTALLSEAKREHFILCLNAYQGRRNVCDLVRSLRALLDGPRRRQLLPLLRLVLPRSDQLLFDQYTAE 108
gi 115734778    1 MSANVLRLHESLTNLLNGQDKAHFVHALNDYNSKRNVYTLVHNLMGILNTPEKKQLYVLLGKVIPSSDQTLFWQHVDA 78
gi 198424460   24 MNVNVYNFQVRMRKVLTKEERNEVTHILSCYHKNRNVYYLTQSLKSVLDNEEKRSIIPLLKQIIPVVDRAAFDQFTCE 101

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap