Conserved Protein Domain Family
NR_DBD_PNR

?
cd06970: NR_DBD_PNR 
DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers
DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. PNR is a member of the nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143528
View PSSM: cd06970
Aligned: 8 rows
Threshold Bit Score: 179.753
Threshold Setting Gi: 195027481
Created: 3-Feb-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
zinc bindingputative DNA
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom
  • Comment:coordination residues derived from related proteins

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                #  #             #  #               #      #         #  #               
gi 45382987   27 KALSPVLLCKVCGDTSSGKHYGIYACNGCSGFFKRSVRRKLIYRCQAGTGLCPVDKAHRNQCQACRLKKCLQAGMNKDAV 106
gi 147900594  24 PAPNPHLLCRVCGDSSSGKHYGIFACNGCSGFFKRSVRRKLIYRCQAGTGLCPVDKAHRNQCQACRLKKCLQTGMNKDAV 103
gi 55925261   31 KVLNTGLLCKVCSDTSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAV 110
gi 7657395    39 TGVSPSLQCRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAV 118
gi 221330285 103 KGQNLGLICVVCGDTSSGKHYGILACNGCSGFFKRSVRRKLIYRCQAGTGRCVVDKAHRNQCQACRLKKCLQMGMNKDAV 182
gi 115722884  25 KRICPGLTCTVCGDISSGKHYGIYACNGCSGFFKRSVRRKLVYRCQAGTGCCLVDKAHRNQCQACRLKKCLDAGMNKDAV 104
gi 195027481  91 KGQNLGLICVVCGDTSSGKHYGILACNGCSGFFKRSVRRKLIYRCQAGTGRCIVDKAHRNQCQACRLKKCLLMGMNKDAV 170
gi 17568335   94 TASSPTLCCAVCGDVSSGKHYGILACNGCSGFFKRSVRRRLIYRCQAGTGNCVVDKAHRNQCQACRLKKCLNKGMNKDAV 173
                         90
                 ....*....|..
Feature 1                    
gi 45382987  107 QNERQPRSTAQV 118
gi 147900594 104 QNERQPRSTAQI 115
gi 55925261  111 QNERQPRSTAQV 122
gi 7657395   119 QNERQPRSTAQV 130
gi 221330285 183 QNERQPRNTATI 194
gi 115722884 105 QNERQPRNMAHV 116
gi 195027481 171 QNERQPRNTATI 182
gi 17568335  174 QNERQPRNTATI 185

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap