Conserved Protein Domain Family
NR_DBD_PNR_like_2

?
cd06957: NR_DBD_PNR_like_2 
DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers
The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR-like receptors have a central well-conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143515
View PSSM: cd06957
Aligned: 9 rows
Threshold Bit Score: 154.543
Threshold Setting Gi: 115534108
Created: 2-Feb-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
zinc bindingputative DNA
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.
  • Comment:coordination residues based on related proteins

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #  #             #  #               #      #         #  #                       
gi 156538639   11 CKVCGDRSYGKHYGVYCCDGCSCFFKRSIRRGVLYTCIaGNGSCVIDKARRNWCPHCRLKKCFAVSMNTAAVQEERGPRS 90
gi 72148318    11 CKVCGDKSYGKHYGVYCCDGCSCFFKRSIRRNMRYTCI-GKGNCLVDKARRNWCPYCRLKKCFAVNMNKSAVQEERGPRK 89
gi 110760367   11 CKVCGDRSYGKHYGVYCCDGCSCFFKRSVRRGALFTCIaGIGACFVDKARRNWCPYCRLKKCFTVGMNTAAVQEERGPRV 90
gi 156556065    7 CKVCGDRSSGKHYGSICCDGCSCFFKRSIRKRAFYTCIsGQGGCSVDKARRNWCPFCRLQKCFLVGMNAAAVQEERGPRI 86
gi 24644582     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIaLVGNCVVDKARRNWCPSCRFQRCLAVGMNAAAVQEERGPRN 86
gi 125776344    7 CEVCGDQSSGKHYGVSCCDGCSCFFKRSVRKGNHYACIaIKGNCIVDKARRNWCPFCRFQRCLAVGMNVAAVQDERGPRN 86
gi 195451294   18 CQVCGDQSSGKHYGVYCCDGCSCFFKRSVRKGNHYVCIaIKGNCIVDKARRNWCPFCRFQRCLAVGMNISAVQEERGPRS 97
gi 115534108   40 CEICGDKSYGRHYGVWACDGCSCFFKRSVRKNIIYTCIaGNWKCVVDKGRRNWCPACRLAKCTRLKMNRLAVQTERGPRR 119
gi 157774147   11 CEICGDKSYGRHYGVWACDGCSCFFKRSVRKNIIYTCIaGNWRCVVDKGRRNWCPACRLAKCTKLNMNRLAVQNERGPRK 90

                  ..
Feature 1           
gi 156538639   91 RS 92
gi 72148318    90 KK 91
gi 110760367   91 RT 92
gi 156556065   87 TE 88
gi 24644582    87 QQ 88
gi 125776344   87 QQ 88
gi 195451294   98 TS 99
gi 115534108  120 LR 121
gi 157774147   91 LR 92

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap