Conserved Protein Domain Family
STKc_PCTAIRE1

?
cd07873: STKc_PCTAIRE1 (this model, PSSM-Id:143378 is obsolete and has been replaced by 270854)
Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase
Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may play a role in regulating neurite outgrowth. It can also associate with Trap (Tudor repeat associator with PCTAIRE-2), a physiological partner of PCTAIRE-2; with p11, a small dimeric protein with similarity to S100; and with 14-3-3 proteins, mediators of phosphorylation-dependent interactions in many different proteins.
Statistics
?
PSSM-Id: 143378
Aligned: 3 rows
Threshold Bit Score: 629.344
Created: 24-Sep-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:based on the structure of human CDK2 bound with ATP and substrate peptide, and on the structures of other CDKs with bound ATP or ATP analogs
  • Citation:PMID 8756328

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                     ####    #            # #               #             #             
266425       158 GFGKLETYIKLDkLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLT 237 human
NP_001088466 185 GFGKLETYIKLDkLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTERTLT 264 African clawed ...
XP_001335575 186 GFGKLETYVKLDkLGEGTYATVYKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTQKSLT 265 zebrafish
Feature 1          ####  # ##                                    # # ## #          #  #          
266425       238 LVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKT 317 human
NP_001088466 265 LVFEYLDKDLKQYLDDCGNLINLHNVKLFLYQLLRGLYYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSIPTKT 344 African clawed ...
XP_001335575 266 LVFEYLDKDLKQYLDDCGNSIHMHNVKLFLFQLLRGLNYCHRRKVLHRDLKPQNLLINDRGELKLADFGLARAKSIPTKT 345 zebrafish
Feature 1         # #### #                                     ##                                
266425       318 YSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGIlsNEEFKT 397 human
NP_001088466 345 YSNEVVTLWYRPPDILLGSTEYSTQIDMWGVGCIFYEMVTGRPLFPGSTVEEQLHFIFRILGTPTEETWPGIlsNEEFKS 424 African clawed ...
XP_001335575 346 YSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMSTGRPLFPGSTVEEELHFIFKLLGTPTEETWPGItsNEEFIS 425 zebrafish
Feature 1                                                                     
266425       398 YNYPKYRAEALLSHAPRLDSDGADLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPD 458 human
NP_001088466 425 YNYPKYYPDPIQKHAARLDSDGAKLLSKLLQLEGRKRISAEEAMKHLYFQELGERIHKLPD 485 African clawed frog
XP_001335575 426 YNYPRYRADCLHNHTPRLDNDGVELLSKLLQFEGKKRIAAEEAMRHPYFHCLGERLLTLPD 486 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap