Conserved Protein Domain Family
STKc_PCTAIRE3

?
cd07871: STKc_PCTAIRE3 (this model, PSSM-Id:143376 is obsolete and has been replaced by 270853)
Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase
Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filaments (PHFs) and stimulate Tau phosphorylation. As AD progresses, phosphorylated Tau aggregates and forms PHFs, which leads to the formation of neurofibrillary tangles (NFTs). In human glioma cells, PCTAIRE-3 induces cell cycle arrest and cell death.
Statistics
?
PSSM-Id: 143376
View PSSM: cd07871
Aligned: 5 rows
Threshold Bit Score: 625.123
Threshold Setting Gi: 116242704
Created: 24-Sep-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:based on the structure of human CDK2 bound with ATP and substrate peptide, and on the structures of other CDKs with bound ATP or ATP analogs
  • Citation:PMID 8756328

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    ####    #            # #               #             #              
Q07002       136 FGKLETYVKLDKLGEGTYATVFKGRSKLteNLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTL 215 human
XP_001919335 127 FGKLETYVKLGKLGEGTYATVFKGRSKLteNLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDIIHTDRCLTL 206 zebrafish
NP_001006837 126 FGKLETYIKLDKLGEGTYATVFKGRSKLtgNLVALKEIRLEHEEGAPCTAIREVSLLKNLKHSNIVTLHDIIHTEYCLTL 205 western clawed ...
CAF96954     132 FGKLETYVKLGKLGEGTYATVFKGRSKLteNLVALKEIRLEHDEGAPCTAIREVSLLKNLKHANIVTLHDIIHTERCLTL 211 spotted green p...
XP_001234978  94 FGKMETYVKLDKLGEGTYATVFKGRSKLteNLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDIIHTERSLTL 173 chicken
Feature 1         ####  # ##                                    # # ## #          #  #           
Q07002       216 VFEYLDSDLKQYLDHCGnlMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTY 295 human
XP_001919335 207 VFEYLDSDLKQYLDNCGnlMSMHNVKIFMFQLLRGLSYCHKRKILHRDLKPQNLLINDKGELKLADFGLARAKSVPTKTY 286 zebrafish
NP_001006837 206 VFEYLDSDLKQYLDNCGnlMCMHNVKIFMFQLLRGLSYCHRRKILHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTY 285 western clawed ...
CAF96954     212 VFEYLDSDLKHYLDNCGnlMSMHNVKIFMFQLLRGLSYCHKRKILHRDLKPQNLLINDKGELKLADFGLARAKSVPTKTY 291 spotted green p...
XP_001234978 174 VFEYLENDLKQYLDNCGnlMSVHNVKIFMFQLLRGLSYCHERKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTY 253 chicken
Feature 1        # #### #                                     ##                                 
Q07002       296 SNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGStVKEELHLIFRLLGTPTEETWPGVtaFSEFRTY 375 human
XP_001919335 287 SNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGRPMFPGStVKEELHLIFRLMGTPTEESWPGItaNEEFKSY 366 zebrafish
NP_001006837 286 SNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGRPMFPGStVKEELHLIFRLLGTPTEETWPGIcsNKEFKGY 365 western clawed ...
CAF96954     292 SNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGRPMFPGAtVKEELHLIFRLMGTPTEDSWPGVssNEEFRSY 371 spotted green p...
XP_001234978 254 SNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMVTGRPMFPGStVKEELHLIFRLLGTPTEDTWPGItsNEEFRAY 333 chicken
Feature 1                                                        
Q07002       376 SFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYF 423 human
XP_001919335 367 LFPQYRAQALINHVPRLDTEGIDLLTALLLYDTKRRISAELSLRHSYF 414 zebrafish
NP_001006837 366 GFPQYRTQPLKNHTPRLDSDGIDLLSSLLLYEDKKRISADMGLRHAYF 413 western clawed frog
CAF96954     372 LFPQYRAQNLINHVPRLDTEGIDLLCALLKFDTRSRISSEAALRHSYF 419 spotted green pufferfish
XP_001234978 334 NFTQYRAQPLINHAPRLDSDGIDLLMNLLLYEAKSRISAEVALRHPYF 381 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap