Conserved Protein Domain Family
STKc_PFTAIRE1

?
cd07869: STKc_PFTAIRE1 
Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 and is inhibited by the p21 cell cycle inhibitor. It has also been shown to interact with the membrane-associated cyclin Y, which recruits the protein to the plasma membrane. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143374
View PSSM: cd07869
Aligned: 3 rows
Threshold Bit Score: 606.305
Threshold Setting Gi: 148236379
Created: 24-Sep-2008
Updated: 2-Mar-2014
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                    ####    #            # #               #             #              
gi 93141297  129 FGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTL 208
gi 148236379  95 FGKADSYEKLEKLGEGSYATVFKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTL 174
gi 118085807 433 FGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTL 512
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ####  # ##                                    # # ## #          #  #           
gi 93141297  209 VFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTY 288
gi 148236379 175 VFEYVHTDLCQYMDKHPGGLNPENVKLFLFQLLRGLSYIHQGHILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTY 254
gi 118085807 513 VFEYVHTDLCQYMDKHPGGLHPENVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTY 592
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        # #### #                                     ##                                 
gi 93141297  289 SNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKP 368
gi 148236379 255 SNEVVTLWYRPPDVLLGSTDYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLILGTPIEETWPAVHSLPHFEP 334
gi 118085807 593 SNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKP 672
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
Feature 1                                                                       
gi 93141297  369 ERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTD 431
gi 148236379 335 ERFTLYGPKNLRQAWNKLSYVNHAEDLASKLLQCFPKNRLSAQAALNHDYFSDLPPRLWELSD 397
gi 118085807 673 ERFTQYSPKNLRQAWNKLSYVNHAEDLASKLLQCFPKNRLSAQAALSHEYFSDLPPRLWELTD 735

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap