2W96,3G33


Conserved Protein Domain Family
STKc_CDK4

?
cd07863: STKc_CDK4 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the nucleus. CDK4 also shows kinase activity towards Smad3, a signal transducer of TGF-beta signaling which modulates transcription and plays a role in cell proliferation and apoptosis. CDK4 is inhibited by the p21 inhibitor and is specifically mutated in human melanoma. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143368
View PSSM: cd07863
Aligned: 4 rows
Threshold Bit Score: 616.204
Threshold Setting Gi: 224983653
Created: 24-Sep-2008
Updated: 2-Mar-2014
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:CDK/cyclin interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                 #### # ### ##  ##  ###        ####  #  
2W96_B         5 RYEPVAEIGVGAYGTVYKARDPhsGHFVALKSVRVPNG---EEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTD 81  human
3G33_A        10 RYEPVAEIGVGAYGTVYKARDPhsGHFVALKSVRVPNGgggGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTD 89  human
Q91727         8 QYEPVAEIGVGAYGTVYKARDLqsGKFVALKNVRVQTN---ENGLPLSTVREVTLLKRLEHFDHPNIVKLMDVCASARTD 84  African clawed ...
NP_001071245   8 QYEPVAEIGGGAYGTVYKARDRdsGQFVALKSVRVQTN---QDGLPLSTVREVALLKRLEQFDHPNIVRLMDVCATLRTD 84  zebrafish
Feature 1                                                                                        
2W96_B        82 REIKVTLVFEHVDQDLRTYLDKAPpPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSgGTVKLADFGLARI 161 human
3G33_A        90 REIKVTLVFEHVDQDLRTYLDKAPpPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSgGTVKLADFGLARI 169 human
Q91727        85 RETKVTLVFEHVDQDLKTYLSKVPpPGLPLETIKDLMKQFLSGLEFLHLNCIVHRDLKPENILVTSgGQVKLADFGLARI 164 African clawed ...
NP_001071245  85 QETKVTLVFEHVDQDLRAYLEKVPaPGLPVDKIRDLMQQLLCGLAFLHTNRVLHRDLKPENILVTSrGQVKLADFGLARI 164 zebrafish
Feature 1                                                                                        
2W96_B       162 YSYQMALDPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSL 241 human
3G33_A       170 YSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSL 249 human
Q91727       165 YSCQMALTPVVVTLWYRAPEVLLQSTYATPVDVWSAGCIFAEMFKRKPLFCGNSEADQLCKIFDIIGLPSEEEWPVDVTL 244 African clawed ...
NP_001071245 165 YSCHMALTPVVVTLWYRSPEVLLQSTYATPVDIWSTGCIFAEMFRRKPLFCGDSEADQLGKIFAVIGLPAEDQWPTDVTL 244 zebrafish
Feature 1                                                           
2W96_B       242 prGAFPPRGPRPVQSVVPEmeESGAQLLLEMLTFNPHKRISAFRALQHSYL 292 human
3G33_A       250 prGAFPPRGPRPVQSVVPEmeESGAQLLLEMLTFNPHKRISAFRALQHSYL 300 human
Q91727       245 prSAFSPRTQQPVDKFVPEidAMGADLLLAMLTFSPQKRISASDALLHPFF 295 African clawed frog
NP_001071245 245 shHNFSPQSPRPITDCVPDitEKGAELLLKMLTFDPLKRISALNALDHPFF 295 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap