Conserved Protein Domain Family
STKc_Sty1_Hog1

?
cd07856: STKc_Sty1_Hog1 (this model, PSSM-Id:143361 is obsolete and has been replaced by 270843)
Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1
Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and UV radiation. Sty1 is regulated by the MAP2K Wis1, which is activated by the MAP3Ks Wis4 and Win1, which receive signals of the stress condition from membrane-spanning histidine kinases Mak1-3. Activated Sty1 stabilizes the Atf1 transcription factor and induces transcription of Atf1-dependent genes of the core environmetal stress response (CESR). Hog1 is the key element in the high osmolarity glycerol (HOG) pathway and is activated upon hyperosmotic stress. Activated Hog1 accumulates in the nucleus and regulates stress-induced transcription. The HOG pathway is mediated by two transmembrane osmosensors, Sln1 and Sho1.
Statistics
?
PSSM-Id: 143361
View PSSM: cd07856
Aligned: 6 rows
Threshold Bit Score: 656.898
Threshold Setting Gi: 169777985
Created: 24-Sep-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                         #### ## #            # #                #             #        
Q09892         9 IFGTCFEITtRYSDLQPIGMGAFGLVCSAKDQLtgMNVAVKKIMKPFSTPVLAKRTYRELKLLKHLRHENIISLSDIFIS 88  Schizosaccharom...
2507192       12 IFGTVFEITnRYNDLNPVGMGAFGLVCSATDTLtsQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLS 91  baker's yeast
AAW42642       9 IFGTVFEVTtRYVDLQPVGMGAFGLVCSAKDQLsgTSVAIKKIMKPFSTPVLSKRTYRELKLLKHLRHENIISLSDIFIS 88  Cryptococcus ne...
XP_001823458   9 VLGSVFDTTnRYVNVRPVGLGAFSLVCSAYDLVrgQAVAIKKLLNPFATTANAKQTYREIKLLKQLRHENLIGLCDVFIS 88  Aspergillus ory...
Q75Q66         9 IFGTTFEITsRYSDLQPVGMGAFGLVCSARDQLtnQNVAVKKIMKPFSTPVLAKRTYRELKLLKHLRHENVISLSDIFIS 88  Colletotrichum ...
CAP91845       9 VMGTVFETTeRYTEWKPLGLGVSGLVCSARDQLthRTVAVKKLVEPFKTPAIARHMFREMKLLRQLRHENIINLTDIFIS 88  Penicillium chr...
Feature 1                ####  # ##                                  # # ## #         ##  #      
Q09892        89 PFEDIYFVTELLGTDLHRLLTSRPLETQFIQYFLYQILRGLKFVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDP 168 Schizosaccharom...
2507192       92 PLEDIYFVTELQGTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDP 171 baker's yeast
AAW42642      89 PLEDIYFVTELLGTDLHRLLTSRPLEKQFIQYFLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDP 168 Cryptococcus ne...
XP_001823458  89 PRTDVYLVTELLSTDLARLLEAGPLEPQFVQYFAYQILRGLKYLHSAGVVHRDIKPSNLVIDENCDLKICDFGLSRPQDH 168 Aspergillus ory...
Q75Q66        89 PLEDIYFVTELLGTDLHRLLTSRPLEKQFIQYFLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDP 168 Colletotrichum ...
CAP91845      89 PSEDIYLVTELMATDLNTILKAKRVEDQFAQYFMYQIMRGLKYLHSAGVIHRDLKPSNILVNENCDLKICDFGLARVQES 168 Penicillium chr...
Feature 1          # #### #                                     #                                
Q09892       169 QMTGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGRDHVNQFSIITELLGTPPMEVIETICSKNTLR 248 Schizosaccharom...
2507192      172 QMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLK 251 baker's yeast
AAW42642     169 QMTGYVSTRYYRAPEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQTIASENTLR 248 Cryptococcus ne...
XP_001823458 169 RMTGYVSTRYYRAPEVMLTWQRYGVEVDIWSAGCVIAEMFNGKPLFPGQDPINQFYLILDVLGNPSDKFISRICTTNTVE 248 Aspergillus ory...
Q75Q66       169 QMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVINTIASENTLR 248 Colletotrichum ...
CAP91845     169 HMTGYVSTRYYRAPEIMLTWRKYNEKVDIWSAGCIFAELLLGEPLFPGKNHINQFCVITDLLGNPPEEVIKNITSENTLN 248 Penicillium chr...
Feature 1                                                                                        
Q09892       249 FVQSLPQKEKVPFAEKFKNaDPDAIDLLEKMLVFDPRKRISAADALAHNYLAPYHDPTDEPvadevFDWSFQDNDLPVET 328 Schizosaccharom...
2507192      252 FVTSLPHRDPIPFSERFKTvEPDAVDLLEKMLVFDPKKRITAADALAHPYSAPYHDPTDEPvadakFDWHFNDADLPVDT 331 baker's yeast
AAW42642     249 FVQSLPKREKVPFSTKFPNaDPVSLDLLEKMLVFDPRTRISAAEGLAHEYLAPYHDPTDEPvaaevFDWSFNDADLPVDT 328 Cryptococcus ne...
XP_001823458 249 IIRSLERREPRPLQSVIQNlDDSARSLLERMLTLDPQERISAEEALQHPYMKMYHDPTDEPiaeerFDWMFNGGEFDKEM 328 Aspergillus ory...
Q75Q66       249 FVKSLPKRERQPLKNKFKNaDPSAIDLLERMLVFDPKKRITATEALSHDYLAPYHDPTDEPvaeekFDWSFNDADLPVDT 328 Colletotrichum ...
CAP91845     249 FINSLPKRNRTPISQLIPKaNAQAAALIDSMLQFDPQVRISATESLASPYLAPYHDPSDEPvatetFDWAFLEADLPADM 328 Penicillium chr...
Feature 1                
Q09892       329 WKVMMYSE 336 Schizosaccharomyces pombe
2507192      332 WRVMMYSE 339 baker's yeast
AAW42642     329 WKVMMYSE 336 Cryptococcus neoformans var. neoformans JEC21
XP_001823458 329 LKEMIPAY 336 Aspergillus oryzae RIB40
Q75Q66       329 WKIMMYSE 336 Colletotrichum lagenarium
CAP91845     329 WKTIMYGE 336 Penicillium chrysogenum Wisconsin 54-1255

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap