Conserved Protein Domain Family
STKc_Sty1_Hog1

?
cd07856: STKc_Sty1_Hog1 (this model, PSSM-Id:143361 is obsolete and has been replaced by 270843)
Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1
Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and UV radiation. Sty1 is regulated by the MAP2K Wis1, which is activated by the MAP3Ks Wis4 and Win1, which receive signals of the stress condition from membrane-spanning histidine kinases Mak1-3. Activated Sty1 stabilizes the Atf1 transcription factor and induces transcription of Atf1-dependent genes of the core environmetal stress response (CESR). Hog1 is the key element in the high osmolarity glycerol (HOG) pathway and is activated upon hyperosmotic stress. Activated Hog1 accumulates in the nucleus and regulates stress-induced transcription. The HOG pathway is mediated by two transmembrane osmosensors, Sln1 and Sho1.
Statistics
?
PSSM-Id: 143361
View PSSM: cd07856
Aligned: 6 rows
Threshold Bit Score: 656.898
Threshold Setting Gi: 169777985
Created: 24-Sep-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                         #### ## #            # #                #             #        
gi 1351129     9 IFGTCFEITtRYSDLQPIGMGAFGLVCSAKDQLtgMNVAVKKIMKPFSTPVLAKRTYRELKLLKHLRHENIISLSDIFIS 88
gi 2507192    12 IFGTVFEITnRYNDLNPVGMGAFGLVCSATDTLtsQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLS 91
gi 57226181    9 IFGTVFEVTtRYVDLQPVGMGAFGLVCSAKDQLsgTSVAIKKIMKPFSTPVLSKRTYRELKLLKHLRHENIISLSDIFIS 88
gi 169777985   9 VLGSVFDTTnRYVNVRPVGLGAFSLVCSAYDLVrgQAVAIKKLLNPFATTANAKQTYREIKLLKQLRHENLIGLCDVFIS 88
gi 74696001    9 IFGTTFEITsRYSDLQPVGMGAFGLVCSARDQLtnQNVAVKKIMKPFSTPVLAKRTYRELKLLKHLRHENVISLSDIFIS 88
gi 211583825   9 VMGTVFETTeRYTEWKPLGLGVSGLVCSARDQLthRTVAVKKLVEPFKTPAIARHMFREMKLLRQLRHENIINLTDIFIS 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                ####  # ##                                  # # ## #         ##  #      
gi 1351129    89 PFEDIYFVTELLGTDLHRLLTSRPLETQFIQYFLYQILRGLKFVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDP 168
gi 2507192    92 PLEDIYFVTELQGTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDP 171
gi 57226181   89 PLEDIYFVTELLGTDLHRLLTSRPLEKQFIQYFLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDP 168
gi 169777985  89 PRTDVYLVTELLSTDLARLLEAGPLEPQFVQYFAYQILRGLKYLHSAGVVHRDIKPSNLVIDENCDLKICDFGLSRPQDH 168
gi 74696001   89 PLEDIYFVTELLGTDLHRLLTSRPLEKQFIQYFLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDP 168
gi 211583825  89 PSEDIYLVTELMATDLNTILKAKRVEDQFAQYFMYQIMRGLKYLHSAGVIHRDLKPSNILVNENCDLKICDFGLARVQES 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          # #### #                                     #                                
gi 1351129   169 QMTGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGRDHVNQFSIITELLGTPPMEVIETICSKNTLR 248
gi 2507192   172 QMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLK 251
gi 57226181  169 QMTGYVSTRYYRAPEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQTIASENTLR 248
gi 169777985 169 RMTGYVSTRYYRAPEVMLTWQRYGVEVDIWSAGCVIAEMFNGKPLFPGQDPINQFYLILDVLGNPSDKFISRICTTNTVE 248
gi 74696001  169 QMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVINTIASENTLR 248
gi 211583825 169 HMTGYVSTRYYRAPEIMLTWRKYNEKVDIWSAGCIFAELLLGEPLFPGKNHINQFCVITDLLGNPPEEVIKNITSENTLN 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 1351129   249 FVQSLPQKEKVPFAEKFKNaDPDAIDLLEKMLVFDPRKRISAADALAHNYLAPYHDPTDEPvadevFDWSFQDNDLPVET 328
gi 2507192   252 FVTSLPHRDPIPFSERFKTvEPDAVDLLEKMLVFDPKKRITAADALAHPYSAPYHDPTDEPvadakFDWHFNDADLPVDT 331
gi 57226181  249 FVQSLPKREKVPFSTKFPNaDPVSLDLLEKMLVFDPRTRISAAEGLAHEYLAPYHDPTDEPvaaevFDWSFNDADLPVDT 328
gi 169777985 249 IIRSLERREPRPLQSVIQNlDDSARSLLERMLTLDPQERISAEEALQHPYMKMYHDPTDEPiaeerFDWMFNGGEFDKEM 328
gi 74696001  249 FVKSLPKRERQPLKNKFKNaDPSAIDLLERMLVFDPKKRITATEALSHDYLAPYHDPTDEPvaeekFDWSFNDADLPVDT 328
gi 211583825 249 FINSLPKRNRTPISQLIPKaNAQAAALIDSMLQFDPQVRISATESLASPYLAPYHDPSDEPvatetFDWAFLEADLPADM 328

                 ....*...
Feature 1                
gi 1351129   329 WKVMMYSE 336
gi 2507192   332 WRVMMYSE 339
gi 57226181  329 WKVMMYSE 336
gi 169777985 329 LKEMIPAY 336
gi 74696001  329 WKIMMYSE 336
gi 211583825 329 WKTIMYGE 336

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap