2FYS,2ERK,2GPH,2Z7L,2B9H,2B9F,2F9G,1GOL,2ZOQ


Conserved Protein Domain Family
STKc_ERK1_2_like

?
cd07849: STKc_ERK1_2_like (this model, PSSM-Id:143354 is obsolete and has been replaced by 270839)
Click on image for an interactive view with Cn3D
Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases
Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase kinase from the Raf family. ERK1/2 have numerous substrates, many of which are nuclear and participate in transcriptional regulation of many cellular processes. They regulate cell growth, cell proliferation, and cell cycle progression from G1 to S phase. Although the distinct roles of ERK1 and ERK2 have not been fully determined, it is known that ERK2 can maintain most functions in the absence of ERK1, and that the deletion of ERK2 is embryonically lethal. The MAPK, Fus3, regulates yeast mating processes including mating-specific gene expression, G1 arrest, mating projection, and cell fusion.
Statistics
?
PSSM-Id: 143354
View PSSM: cd07849
Aligned: 29 rows
Threshold Bit Score: 581.177
Threshold Setting Gi: 199433018
Created: 18-Jul-2006
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 33 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:based on the structure of human CDK2 bound with ATP and substrate peptide, the structure of human ERK1 bound with inhibitor, the structure of rat ERK2 bound with MgATP, and the structure of yeast Fus3 bound with MgADP
  • Citation:PMID 8107865

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                    #### ## #            # #               #              #             
2FYS_A        23 FDVGPRYTNLSYIGEGAYGMVCSAYDNLnkVRVAIKKISPFEHQTYCQRTLREIKILLRFR-HENIIGINDIIRAPTieQ 101
gi 134834     33 FELPEEYEMINLIGQGAYGVVCAALHKPsgLKVAVKKIHPFNHPVFCLRTLREIKLLRHFR-HENIISILDILPPPSyqE 111
2B9H_A         7 YNISSDFQLKSLLGEGAYGVVCSATHKPtgEIVAIKKIEPFDKPLFALRTLREIKILKHFK-HENIITIFNIQRPDSfeN 85
2B9F_A         7 YNISSDFQLKSLLGEGAYGVVCSATHKPtgEIVAIKKIEPFDKPLFALRTLREIKILKHFK-HENIITIFNIQRPDSfeN 85
gi 41688570   17 FNVSEQYDIQDVVGEGAYGVVCSAIHKPsgQKVAIKKITPFDHSMFCLRTLREMKLLRYFN-HENIISILDIQKPRNyeS 95
gi 1169549    62 FNVSDHYQILEIVGEGAYGIVCSAIHKPsqQKVAIKKIEPFERSMLCLRTLRELKLLKHFN-HENIISILAIQRPINyeS 140
gi 2852373    10 FNVSDDYEILDVIGEGAYGIVCSAIHKPsgQKVAIKKISPFDHSMFCLRTLREMKLLRYFN-HENIISILDIQQPQDfeS 88
2F9G_A         7 YNISSDFQLKSLLGEGAYGVVCSATHKPtgEIVAIKKIEPFDKPLFALRTLREIKILKHFK-HENIITIFNIQRPDSfeN 85
gi 238031348  26 YNISSDYRIQRVLGEGAYGIVCLAKHLPtgTDVAIKKIQPFERTLFCLRTLREIKILKHFK-HENIVALLDVQKPMSleT 104
gi 199433018  11 FNISQNFQVIQVVGEGAYGVVCLAIHKPtgIKVAIKKLEPFEKPLFCLRALREIKLLTYFKkHENIISIFDVQKPLNfeN 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1               ####  # ##                                  # # ## #         ##  #       
2FYS_A       102 MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADP- 180
gi 134834    112 LEDVYIVQELMETDLYRVIRSQPLSDDHCQYFTYQILRALKAMHSAGVVHRDLKPSNLLLNANCDLKVADFGLARSTTA- 190
2B9H_A        86 FNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDEs 165
2B9F_A        86 FNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDEs 165
gi 41688570   96 FNEVYLIQELMETDMHRAIRTQDLSDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAAS- 174
gi 1169549   141 FNEIYLIQELMETDLHRVIRTQNLSDDHIQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNSNCDLKICDFGLARSIAS- 219
gi 2852373    89 FSEVYLIQELMETDMHRVIRTQDLSDDHCQYFIYQILRALKAMHSADILHRDLKPSNLLLNANCDLKVCDFGLARSAVS- 167
2F9G_A        86 FNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDEs 165
gi 238031348 105 FNEVYLIQEYMETDLHKVILSQNLTNDHYQYFIYQILRALKSLHGCNIVHRDLKPSNILLNSNCDLKVCDFGLSRVHLNd 184
gi 199433018  91 FNEIYLIQEYMPSDLHKTIATQNLTDDHIQYFIYQILRGLKLIHSANVIHRDLKPSNILVNENCDLKICDFGLARLDILk 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                         # #### #                                     #                 
2FYS_A       181 ------DHDHTG---FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSP 251
gi 134834    191 ------QGGNPG---FMTEYVATRWYRAPEIMLSFREYSKAIDLWSTGCILAEMLSARPLFPGKDYHSQITLILNILGTP 261
2B9H_A       166 a---adNSEPTGqqsGMVEFVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTP 242
2B9F_A       166 a---adNSEPTGqqsGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTP 242
gi 41688570  175 ------QEDNSG---FMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVLGTP 245
gi 1169549   220 ------QEDNYG---FMTEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLSGRPLFPGRDYHNQLWLIMEVLGTP 290
gi 2852373   168 ------TEDSSS---FMTEYVATRWYRAPEIMLTFKEYTKAIDIWSVGCILAEMLSGRPLFPGKDYHHQLMLILDVLGTP 238
2F9G_A       166 a---adNSEPTGqqsGMTEXVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTP 242
gi 238031348 185 dg--raSHVPKIs--MLTEYVATRWYRAPEIMLTSSQYSTAIDMWAVGCILAELYLRKPLFPGKDYRHQLLLIFEIIGTP 260
gi 199433018 171 egydkrLAINSGi-sMLTEYVATRWYRAPEIMLTSSQYSTAIDMWSVGCILAELFTCTPLFPGNDYRHQLILIFQLLGTP 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2FYS_A       252 SQ-EDLNCIINLKARNYLLSLPHKNKVPWNRLFPNa---------------DSKALDLLDKMLTFNPHKRIEvEQALAHP 315
gi 134834    262 TM-DDFSRIKSARARKYIKSLPFTPKVSFKALFPQa---------------SPDAIDLLEKLLTFNPDKRITaEEALKHP 325
2B9H_A       243 HSdNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRv---------------NPKGIDLLQRMLVFDPAKRITaKEALEHP 307
2B9F_A       243 HSdNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRv---------------NPKGIDLLQRMLVFDPAKRITaKEALEHP 307
gi 41688570  246 TM-EDYYGIKSRRAREYIRSLPFKKKVPFRTLFPKt---------------SDLALDLLEKLLAFNPVKRITvEEALKHP 309
gi 1169549   291 NM-EDYYNIKSKRAREYIRSLPFCKKIPFSELFANtnnntstsntggrtniNPLALDLLEKLLIFNPAKRITvEDALKHP 369
gi 2852373   239 TM-EDYYGIKSRRAREYIRSLPFKKRVSFASIFPRa---------------NPLALDLLEKLLAFNPAKRVTaEEALQHN 302
2F9G_A       243 HSdNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRv---------------NPKGIDLLQRMLVFDPAKRITaKEALEHP 307
gi 238031348 261 TG-IDYQSIKSVKAKEYIKSLPCYSKIPFGKIFRHn---------------DPQGLDLLGKLLTFNPQNRISvEEALSHP 324
gi 199433018 250 TD-ADLTCIKSQRAKNYIKTLPYCSPLSLDQVFNRhpnrakr---fggqpiNPLGLDLLKKLLVFDPKERLTvEEALEHP 325
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*....
Feature 1                                                         
2FYS_A       316 YLeQYYDPSDEPIae--aPFKFDMel-----ddLPKEKLKELIFEETAR 357
gi 134834    326 YVaAYHDASDEPTa---sPMPPNLvdlycnkedLEIPVLKALIFREVNF 371
2B9H_A       308 YLqTYHDPNDEPEg---ePIPPSFfefdhykeaLTTKDLKKLIWNEIFS 353
2B9F_A       308 YLqTYHDPNDEPEg---ePIPPSFfefdhykeaLTTKDLKKLIWNEIFS 353
gi 41688570  310 YLePYHDPEDEPTa---pPIPEEFfdfdkhkdnLSKEQLKQLIYQEIMR 355
gi 1169549   370 YLqLYHDPNDEPIs---dKIPEDFfdfdkmkdqLTIEDLKKLLYEEIMK 415
gi 2852373   303 YLePYHDPDDEPTappisPSFFDFdri---kdsLTKNDLKILIYKEIMS 348
2F9G_A       308 YLqTYHDPNDEPEg---ePIPPSFfefdhykeaLTTKDLKKLIWNEIFS 353
gi 238031348 325 YLsSYHDPLDEPFs---nPIPPDFfsfdtekaqMDGNELKKLLYQEIMT 370
gi 199433018 326 YVsTYHDPEDEPTi---mPIPHEDfefdkskdkLSILELKRQLYNDIIK 371

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap