Conserved Protein Domain Family
STKc_CdkB_plant

?
cd07837: STKc_CdkB_plant (this model, PSSM-Id:143342 is obsolete and has been replaced by 270830)
Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase
Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developmental pathways, such as stomata and leaf development. CdkB has been shown to associate with both cyclin B, which controls G2/M transition, and cyclin D, which acts as a mediator in linking extracellular signals to the cell cycle.
Statistics
?
Aligned: 6 rows
Threshold Bit Score: 556.731
Threshold Setting Gi: 162605840
Created: 24-Sep-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:based on the structure of human CDK2 bound with ATP and substrate peptide, and on the structures of other CDKs with bound ATP or ATP analogs
  • Citation:PMID 8756328

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                ####    #            # #                #              #                
NP_001031507   2 EKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEmDEEGIPPTALREISLLQMLsqSIYIVRLLCVEHviqskdstv 81  thale cress
XP_001759200   2 DEYEKLEKIGEGTYGKVYKARNKSTGRLVALKKTRLEmEDEGVPSTALREVSLLQMLshSIYIVRLLSVESvden----- 76  Physcomitrella ...
AAD08721       2 DAYEKLEKIGEGTYGKVYKARDINTGKLVALKKTRLEmEEEGVPSTTLREVSLLLMLseSNHVVKLIAVEHveen----- 76  Dunaliella tert...
AAV68596       8 DAYEKLEKIGQGTYGKVYKARDRATGRLVALKKTRLEmEEEGVPSTALREVSLLQMLseSPYIVRLLRVEHveed----- 82  Ostreococcus tauri
ABK22232       2 DAYEKLEKVGEGTYGKVYKAKDKNTGQLVALKKTRLEsDDEGIPPTALREISLLQMLsqDIHIVRLLDVEHtenk----- 76  Sitka spruce
XP_001713435   2 DNYKRIEILGQGAYGKVYKAQDLRNGNLVALKKALSSsDEEGIPPTTLREISILKSVseCEFIVKLLDVVNtksk----- 76  Guillardia theta
Feature 1                   ####  # ##                                         # # ## #          
NP_001031507  82 shspksNLYLVFEYLDTDLKKFIDSHrkgsnprPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDkdkGILKI 161 thale cress
XP_001759200  77 ---gkpQLYLVFEYLDSDLKKFIDSYgrg-sgnPIPAKTIQSFMYQLLKGVAHCHGHGVMHRDLKPQNLLVDkekGLLKI 152 Physcomitrella ...
AAD08721      77 ---gkpCLYLVFEYLSTDMKKWMDRNgrg-pahPLPKPAIKSLTYQLIKGLAHCHKHGVMHRDLKPQNLLVDdsiMCCKI 152 Dunaliella tert...
AAV68596      83 ---gkaMLYLVFEFLDQDLKQFMDLTgrg-psnPLPTTTVQNYMYQLCLGCAHLHKHGVMHRDLKPQNMLVDkakNLLKI 158 Ostreococcus tauri
ABK22232      77 --ngkpLLYLVFEYMDSDLKKYIDGYrrs--htKMPPKIIKSFMYQLCQGVAYCHSRGVMHRDLKPHNILVDkqrGVIKI 152 Sitka spruce
XP_001713435  77 --ngkiSIYIVFQYLDSDLKSYMISNygk--grGMDENSAKKFCFQLLIGMYHCHKLGIIHRDLKPQNILIEk-gEKLKI 151 Guillardia theta
Feature 1         #  #           # #### #                                     ##                 
NP_001031507 162 ADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGsthYSTAVDIWSVGCIFAEMIRrQALFPGDsEFQQLLHIFRLLGTPT 241 thale cress
XP_001759200 153 ADLGLGRAFTIPLKSYTHEIVTLWYRAPEVLLGssqYSTSVDMWSVGCIFAELSRkAPLFPGDsELQQLLHIFRLLGTPT 232 Physcomitrella ...
AAD08721     153 ADLGLGRAFSIPIKSYTHEIVTLWYRAPEVLLGsthYSTPVDMWSVGCIFAELVRkTPLFPGDcELQQLLHIFKLLGTPN 232 Dunaliella tert...
AAV68596     159 ADLGLGRAFSVPVKSYTHEIVTLWYRAPEVLLGgshYSTPVDMWSVGCMFAEMARkQPLFPGDsELQQLLHIFKLLGTPS 238 Ostreococcus tauri
ABK22232     153 ADLGLGRAFTIPIKKYTHEIVTLWYRAPEVLLGathYSTPVDIWSVGCIFAEMSRmQALFIGDsEVQQLFKIFRFLGTPN 232 Sitka spruce
XP_001713435 152 ADFGLSRNFSIPVGKYTHEVVTLWYRAPEILLGartYSSPVDIWSIGCIFAEMLTgNPLFCGEsEIEQLLSIFKTIGTPT 231 Guillardia theta
Feature 1                                                                       
NP_001031507 242 EQQWPGVMALRDWHVYPKWEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYFD 304 thale cress
XP_001759200 233 EESWPGVKKLRDWHEYPQWQPQNLSRAVPDMGPEALDLLTRMLMFDPAKRVSAKAALNHPFFD 295 Physcomitrella patens subsp. patens
AAD08721     233 EEVWPGVSKLRDWHEFPQWHPQDLSRIFPTLEPEGVDLLKRMIEYDPAKRISAKEALKHPYFD 295 Dunaliella tertiolecta
AAV68596     239 EQVWPGVSNLRDWHEFPQWKPQDLAKLIPQLDAHGIDLLQKLLVFDPAKRIHATDALEHPYFD 301 Ostreococcus tauri
ABK22232     233 EEIWPGVTKLRDWHIYPQWKPQDISSAVPDLEPSGVDLLSKMLAYEPSKRISAKKALQHPYFD 295 Sitka spruce
XP_001713435 232 SQTWPEVLNFKDWHEFPIWPQINLKYSFENISEETLEFIQVFLRLNPNKRISILGAITNTYFE 294 Guillardia theta

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap