Conserved Protein Domain Family
STKc_CdkB_plant

?
cd07837: STKc_CdkB_plant (this model, PSSM-Id:143342 is obsolete and has been replaced by 270830)
Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase
Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developmental pathways, such as stomata and leaf development. CdkB has been shown to associate with both cyclin B, which controls G2/M transition, and cyclin D, which acts as a mediator in linking extracellular signals to the cell cycle.
Statistics
?
PSSM-Id: 143342
View PSSM: cd07837
Aligned: 6 rows
Threshold Bit Score: 556.731
Threshold Setting Gi: 162605840
Created: 24-Sep-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:based on the structure of human CDK2 bound with ATP and substrate peptide, and on the structures of other CDKs with bound ATP or ATP analogs
  • Citation:PMID 8756328

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                ####    #            # #                #              #                
gi 79324650    2 EKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEmDEEGIPPTALREISLLQMLsqSIYIVRLLCVEHviqskdstv 81
gi 168013022   2 DEYEKLEKIGEGTYGKVYKARNKSTGRLVALKKTRLEmEDEGVPSTALREVSLLQMLshSIYIVRLLSVESvden----- 76
gi 4165329     2 DAYEKLEKIGEGTYGKVYKARDINTGKLVALKKTRLEmEEEGVPSTTLREVSLLLMLseSNHVVKLIAVEHveen----- 76
gi 55977992    8 DAYEKLEKIGQGTYGKVYKARDRATGRLVALKKTRLEmEEEGVPSTALREVSLLQMLseSPYIVRLLRVEHveed----- 82
gi 116781765   2 DAYEKLEKVGEGTYGKVYKAKDKNTGQLVALKKTRLEsDDEGIPPTALREISLLQMLsqDIHIVRLLDVEHtenk----- 76
gi 162605840   2 DNYKRIEILGQGAYGKVYKAQDLRNGNLVALKKALSSsDEEGIPPTTLREISILKSVseCEFIVKLLDVVNtksk----- 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   ####  # ##                                         # # ## #          
gi 79324650   82 shspksNLYLVFEYLDTDLKKFIDSHrkgsnprPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDkdkGILKI 161
gi 168013022  77 ---gkpQLYLVFEYLDSDLKKFIDSYgrg-sgnPIPAKTIQSFMYQLLKGVAHCHGHGVMHRDLKPQNLLVDkekGLLKI 152
gi 4165329    77 ---gkpCLYLVFEYLSTDMKKWMDRNgrg-pahPLPKPAIKSLTYQLIKGLAHCHKHGVMHRDLKPQNLLVDdsiMCCKI 152
gi 55977992   83 ---gkaMLYLVFEFLDQDLKQFMDLTgrg-psnPLPTTTVQNYMYQLCLGCAHLHKHGVMHRDLKPQNMLVDkakNLLKI 158
gi 116781765  77 --ngkpLLYLVFEYMDSDLKKYIDGYrrs--htKMPPKIIKSFMYQLCQGVAYCHSRGVMHRDLKPHNILVDkqrGVIKI 152
gi 162605840  77 --ngkiSIYIVFQYLDSDLKSYMISNygk--grGMDENSAKKFCFQLLIGMYHCHKLGIIHRDLKPQNILIEk-gEKLKI 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #  #           # #### #                                     ##                 
gi 79324650  162 ADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGsthYSTAVDIWSVGCIFAEMIRrQALFPGDsEFQQLLHIFRLLGTPT 241
gi 168013022 153 ADLGLGRAFTIPLKSYTHEIVTLWYRAPEVLLGssqYSTSVDMWSVGCIFAELSRkAPLFPGDsELQQLLHIFRLLGTPT 232
gi 4165329   153 ADLGLGRAFSIPIKSYTHEIVTLWYRAPEVLLGsthYSTPVDMWSVGCIFAELVRkTPLFPGDcELQQLLHIFKLLGTPN 232
gi 55977992  159 ADLGLGRAFSVPVKSYTHEIVTLWYRAPEVLLGgshYSTPVDMWSVGCMFAEMARkQPLFPGDsELQQLLHIFKLLGTPS 238
gi 116781765 153 ADLGLGRAFTIPIKKYTHEIVTLWYRAPEVLLGathYSTPVDIWSVGCIFAEMSRmQALFIGDsEVQQLFKIFRFLGTPN 232
gi 162605840 152 ADFGLSRNFSIPVGKYTHEVVTLWYRAPEILLGartYSSPVDIWSIGCIFAEMLTgNPLFCGEsEIEQLLSIFKTIGTPT 231
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
Feature 1                                                                       
gi 79324650  242 EQQWPGVMALRDWHVYPKWEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYFD 304
gi 168013022 233 EESWPGVKKLRDWHEYPQWQPQNLSRAVPDMGPEALDLLTRMLMFDPAKRVSAKAALNHPFFD 295
gi 4165329   233 EEVWPGVSKLRDWHEFPQWHPQDLSRIFPTLEPEGVDLLKRMIEYDPAKRISAKEALKHPYFD 295
gi 55977992  239 EQVWPGVSNLRDWHEFPQWKPQDLAKLIPQLDAHGIDLLQKLLVFDPAKRIHATDALEHPYFD 301
gi 116781765 233 EEIWPGVTKLRDWHIYPQWKPQDISSAVPDLEPSGVDLLSKMLAYEPSKRISAKKALQHPYFD 295
gi 162605840 232 SQTWPEVLNFKDWHEFPIWPQINLKYSFENISEETLEFIQVFLRLNPNKRISILGAITNTYFE 294

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap