Conserved Protein Domain Family
PTZ00176

?
PTZ00176: PTZ00176 
erythrocyte membrane protein 1 (PfEMP1); Provisional
Statistics
?
PSSM-Id: 140204
View PSSM: PTZ00176
Aligned: 3 rows
Threshold Bit Score: 2496.82
Threshold Setting Gi: 124505649
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PTZ00176 is classified as a model that may span more than one domain.
PTZ00176 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351     9 GGNKSVNITESEKSARNVLEKIGRHIKDEINKNSNHTNKLKGTLSNAQFHDGLHKAAGWgVRYGPANSCDLEHRFYTNIN 88
gi 124505649    1 MALKKGVINESKLSARNVLENIANEIKVKRENERKYNDKLKGSLWEARFSDGLSSSFGD-IRSGYYDSCSLDHKFHTNIN 79
gi 124507287    1 MAPKNGSRNGKLLSLRDVLENIGSGIKDKRKNQSKYTDKLKGILTKAKFVDGLSSRYGY-VRDSDGISCNLSHKFHTNIT 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351    89 NGYLPARNPCHNRNQNRFDENAEAYCNSDKIRGNENNSNAGACAPFRRQNLCDKNLEYLINENTKTTHDLLGNVLVTAKY 168
gi 124505649   80 NGYPPARNPCDGRNQERFSNDGESKCGSDKIRGNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKY 159
gi 124507287   80 --IEAARDPCYGREQNRFDENVESYCNNDKIRGSGKIFDGRVCVPPRRQHICDHNLEYLNNNNTDDTDDLLGNVLVTAKY 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   169 EGDYIVNNHPNRG----SSEVCIALARSFADIGDIVRGKDMFKSN--DNVENGLREVFKKIYEGFLDKGAREHYKEVKNG 242
gi 124505649  160 EGESIVNNHPDKDikgnKSSICTSLARSFADIGDIIRGKDMFKRNkhDNIEKGLREVFKKIYEGLKNNGAREHYKEVKNG 239
gi 124507287  158 EGQSIVNNHPHKE----TSDVCTALARSFADIGDIVRGIDMFKPNdqDEVWNGLRSVFKKIHDNLSSE-VKNAYPDDGSG 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   243 NYIKLREDWWTANRDQVWKAMTCVAPENAYFRKTEADGIGISSLILPYSKCGRDTDPPVVDYIPQRLRWMSEWSEYFCNV 322
gi 124505649  240 NYIKLREDWWTANRDQVWKAITCEAPENAYIIKRRIDGGDIENLILTHPKCGHDTDPPVVDYIPQRLRWMSEWSEYFCNV 319
gi 124507287  233 NYFKLREDWWTANRDQVWKAMTCVAPENAYFRKTEADGIGISSLILPYSKCGRDTDPPVVDYIPQRLRWMSEWSEYFCNV 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   323 LNKEIDEMNNQCKDCEMSRRCNNDTEGEKCKKCKEQCQIFKELVSKWKNEFDKQSMKYKELYIKASTNITKQNSSSPERG 402
gi 124505649  320 LNKEIDEMNNQCKDCEMSRRCNNDTEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKASTNITKQNSSAPERG 399
gi 124507287  313 LNKEIDEMNNQCKDCEMSRRCNDDSEGGKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKASTNITKQNSSAPERG 392
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   403 YRRNHRRRGYDDDTNVQLFLKKVIENNECKVESLGKYLDKTSHCGNYNFNYDNIPGSNRPNAFEIPPEKFKKACKCKIPN 482
gi 124505649  400 YRRNHRRRGYDDDTNVQLFLKKVIENNECKVESLGKYLDKTSHCGNYNFNYDNTPGSNRSNAFEITPEKFKKACKCKIPN 479
gi 124507287  393 YRRNHRRRGYDDDTNVQLFLKKVIENNECKVESLGKYLDKTSHCGNYNFNYDNTPGSNRSNAFEITPEKFKKACKCKIPN 472
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   483 PLEKCPNEENKNVCTRFDKVSSCTSLFFKNDLIEWNNSGVKNKENDNNGVLVPPRRRNLCINLFSKKDYKMKDENDFKED 562
gi 124505649  480 PLEKCPNEENKNVCTRFDKVYSCTSLSFKNDLSEWNNSGVKNKENDNNGVLVPPRRRNLCINLFSKKDYKMKDENDFKED 559
gi 124507287  473 PLEKCPNEENKNVCTRFDKVYSCTSLSFKNDLSEWNNSGVKNKENDNNGVLVPPRRRNLCINLFSKKDYKMKDENDFKED 552
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   563 LLNAAFSQGKLLGKKYSNYSNEAYEAMKFSYADYSDIVKGTDMMNDLKKLNKELNTLLKETEKGDISVDRKTWWDDNKNV 642
gi 124505649  560 LLNAAFSQGKLLGKKYSNYSNEAYEAMKFSYADYSDIVKGTDMMNDLKKLNKELNTLLKETEKGDISVDRKTWWDDNKNV 639
gi 124507287  553 LLNAAFSQGKLLGKKYSNYSNEAYEAMKFSYADYSDIVKGTDMMNDLKKLNKELNTLLKETEKGDISVDRKTWWDDNKNV 632
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   643 VWNAMLCGYKTENENQQLNSSWCNVPDDDNIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDIVEGRKHKSMVDITDVEC 722
gi 124505649  640 VWNAMLCGYKTENENQQLNSSWCNVPDDDNIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDIVEGRKHKSMVDITDVEC 719
gi 124507287  633 VWNAMLCGYKTENENQQLNSSWCNVPDDDYIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDIVEGRKHKSMVDITDVEC 712
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   723 KRLFIDYEEWFRYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAASYVTKHCNGCICNLRDMEDIHKNINNQNELMKEMI 802
gi 124505649  720 KRLFIDYEEWFRYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAASYVTKHCNGCICNLRDMEDIHKNINNQNELMKEMI 799
gi 124507287  713 KRLFIDYEEWFRYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAASYVTKHCNGCICNLRDMEDIHKNINNQNELMKEMI 792
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   803 NIIKFDTDQYRTQLQNISNSMEINPKSVKTAVDTTKDIVSYGLAGTMGVAAIGLQAGDFLGKKIQDLYNEFMKPVEKKLD 882
gi 124505649  800 NIIKFDTDQYRTQLQNISNSMEINTKSVKTAVDTTKDIVSYGLAGTMGVAAIGLQAGDFLGKKIQDLYNEFMKPVEKKLD 879
gi 124507287  793 NIIKFDTDQYRTQLQNISNSMEINPKSVKTAVDTTKDIVSYGLAGTMGVAAIGLQAGDFLGKKIQDLYNEFMKPVEKKLD 872
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   883 TSSKNLNIYEDPNIMVPAGIGVALTLGLLLFKMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYLY 962
gi 124505649  880 TSSKNLNIYEDPNIMVPAGIGVALTLGLLLFKMRTKPKHEVDMIRILQMSQNKYGIPTTKSPNKYIPYASQRYKGKTYIY 959
gi 124507287  873 TSSKNLNIYEDPNIMVPAGIGVALTLGLLLFKMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYLY 952
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351   963 VEGDT-DEEKYMFMSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTQNDIPSDNT--------PSYKL 1033
gi 124505649  960 MEGDSgDEDKYIGNISSSDITSSESEYEEMDINDIYPYTSPKYKTLIEVVLEPSKSNGNTPSKGDGNtvgddmvpTTNTF 1039
gi 124507287  953 VEGDT-DEEKYMFMSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTQNDIPSDNT--------PSYKL 1023
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351  1034 TDEEWNQLKDDFISQYLPNTEPN--NNYRSGNSPTNTNNTTTSHDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTNND 1111
gi 124505649 1040 TDEEWSELKHDFISNMLQNQPNDvpNDYKSGDIPFNTQPNTLYFDNNQEKPFITSIHDRDLYTGEEISYNIHMSTNSMDD 1119
gi 124507287 1024 TDEEWNQLKDDFISQYLPNTEPN--NNYRSGNSPTNTNNTTTSHDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTMDD 1101
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351  1112 iPKYVSNNVYSGIDLINDTL-SGNKHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLYRHR 1190
gi 124505649 1120 -PKYVSNNVYSGIDLINDTL-SGNQHIDIYDEVLKRKENELFGTNHPKNTSNNSVAKLT-NSDPIMNQLDLLHKWLDRHR 1196
gi 124507287 1102 -PKYVSNNVYSGIDLINDSLnSGNQPIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLDRHR 1180
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86170351  1191 DMCEKWENHHERLAKLKEKWENDND-GGNVPSDNHVLNTDVSIEIDMDNPKPINQFSNMDInvdtpTMDNMEDDIYYDVN 1269
gi 124505649 1197 DMCDKWNTKEDILNKLNEQWNKDNNvGGDIPNDNKMLNTDVSIQIDIDENKGKKDLSNMDT-----ILDDMEDDIYYDVN 1271
gi 124507287 1181 DMCEKWENHHERLAKLKEKWENDND-GGNVPSGNHVLNTDVSIEIDMDNPKPINQFSNMDInvdtpTMDNMEDDIYYDVN 1259
                        1290      1300      1310      1320      1330
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 86170351  1270 DNDDDNDQPSVYDIPMDHNKVDVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1325
gi 124505649 1272 DNDDDNDQPSVYDISMDHNKVDVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1327
gi 124507287 1260 DNDDDNDQPSVYDIPMDHNKVDVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap