Conserved Protein Domain Family
Wrch_1

?
cd04130: Wrch_1 
Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42
Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42. Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation. Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function. The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells. Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes. The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Statistics
?
PSSM-Id: 133330
View PSSM: cd04130
Aligned: 10 rows
Threshold Bit Score: 294.695
Threshold Setting Gi: 66772305
Created: 23-Jun-2005
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Rho molecules assume an active conformation when bound to GTP and inactive when GTP is hydrolyzed to GDP
  • Comment:Mg2+ ion plays a key role in bringing together the functional regions of the phosphate-binding, switches I and II
  • Citation:PMID 9545299

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                ######                                      ## #                       
gi 15077780  50 VKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQ---------------------- 107
gi 30962139  39 LKCVLLGDGAVGKTSLVVSYSTNGYPTEYVPTAFDNYSVRIEIDGNALRLQICDTAGQ---------------------- 96
gi 11527801  36 LKCILLGDGAVGKTSLLVSYTTNGYPTRYIPTAFDDFSALVQVEDTPVKLQLCDTAGQ---------------------- 93
gi 16508170  32 IKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQ---------------------- 89
gi 17560062  10 LKCIFVGNAAVGKTSMIVSYTTNVYPHNYVPTAFDNFSVVVLVDKKPIRLQLHDTAGQ---------------------- 67
gi 55925375  47 VKCVLVGDGAVGKTSLIVSYTTNGYPTEYVPTAFDNFAAVVAVDGKPVKLQLCDTAGQ---------------------- 104
gi 50417995  32 IKCVLVGDGAVGKTSLVISYTINGYPTEYQPTALDTFSVQVLVDGAPVRIQLCDTAGQ---------------------- 89
gi 59276034  30 ISCMLVGDGAVGKTSMIVSYTTNGYPTDYKQTAFDVFSGQVQVDGTPVRIQLMDTAGQ---------------------- 87
gi 66772305  27 IKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQ---------------------- 84
gi 47230243   1 LSCMLVGDGAVGKTSMIISYIFNGYNSNYTQTAFDVFTGLVHVNGVPTRIKLIDSAGQvdlahnvrvslsraypsqlslc 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                 # #                   
gi 15077780 108 ----DEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRChcPKAPIILVGTQSDLRedvkvlie-ldkckekP 182
gi 30962139  97 ----DEFDGMRPLCYPGTDVVLVCFSVVRPTSLCNIRDKWLPEIKKylPKVPVVLVGTQTDLRtsldvlvd-laryserP 171
gi 11527801  94 ----DEFDKLRHFCYPKTDVLILCFSVVSPSSFQNISEKWVSEIQChcPNVPVVLLGTQCDLRedvkvliq-laryqdkP 168
gi 16508170  90 ----EDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRThnPQAPVLLVGTQADLRddvnvliqldqggregP 165
gi 17560062  68 ----SSFDTLRPLCYTDADVFVIVYSVVDLQSFEDVSHHWYPEVTKrnPGTKLILVGTQADQRwqv----------rgnT 133
gi 55925375 105 ----DEFDKLRPLCYTNADVFLLCFSVVSPSSFQNVREKWVPEIRRhcPRAPILLVGTQSDLRedvkvliq-laqykerP 179
gi 50417995  90 ----EDFDHLRSLCYSETDVFLVCFSVVNPSSFQNVTEKWIPEIRThsPHTPIVLVGTQADLRddvnvlin-lsqshvkP 164
gi 59276034  88 ----EEFDEFRSLSYAHTDVFLLCFSVVNPTSFQNITKKWIPEIREcnPSSPIILVGTQSDLVldvnvlid-ldrykvkP 162
gi 66772305  85 ----DTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAK--TKAALILVGTQADLRtspnvlnk-lqtngeeA 157
gi 47230243  81 llsqEEFGHLRALCYAHVDVFILCFSLVNPVSFQNIASKWIPQIRSgnRTSPIVLVGTQSDLCqsvdilih-laqhgtkP 159
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
Feature 1                             ##                
gi 15077780 183 VPEEAAKLCAEEIKAaSYIECSALTQKNLKEVFDAAIVAG 222
gi 30962139 172 VTTEEAGAFAKQCGAcGYVECSALTQKNLKQVFDTAILEG 211
gi 11527801 169 VSNSSARALAEKIGAvAYVECSALTQKNLKEVFDTAIVSG 208
gi 16508170 166 VPQPQAQGLAEKIRAcCYLECSALTQKNLKEVFDSAILSA 205
gi 17560062 134 VTQLRGKALADRLGA-EFFECSALTQHNLKQMFDAAILAG 172
gi 55925375 180 VEPQDASVCAEEVQAvSYMECSALTQKNLKEVFDTAIVAS 219
gi 50417995 165 VSESQAQAVAQKIRAqTYIECSALTQKNLKEVFDASILSA 204
gi 59276034 163 VCSSRARSLSEKIRAaEYVECSALTQKNLKEAFDAAIFAA 202
gi 66772305 158 ISYADAWDLATTIGA-KYIETSSATQDKVKDVFDTAIWEG 196
gi 47230243 160 VAHGRATRLARRIGAgDYLECSALTQHNLKDVFDSAVFAA 199

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap