Conserved Protein Domain Family
PTKc_Kit

?
cd05104: PTKc_Kit (this model, PSSM-Id:133235 is obsolete and has been replaced by 270682)
Catalytic domain of the Protein Tyrosine Kinase, Kit
Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem cells, the interstitial cells of Cajal, and the pacemaker cells of the GI tract. Kit signaling is involved in major cellular functions including cell survival, proliferation, differentiation, adhesion, and chemotaxis. Mutations in Kit, which result in constitutive ligand-independent activation, are found in human cancers such as gastrointestinal stromal tumor (GIST) and testicular germ cell tumor (TGCT). The aberrant expression of Kit and/or SCF is associated with other tumor types such as systemic mastocytosis and cancers of the breast, neurons, lung, prostate, colon, and rectum. Although the structure of the human Kit catalytic domain is known, it is excluded from this specific alignment model because it contains a deletion in its sequence.
Statistics
?
PSSM-Id: 133235
View PSSM: cd05104
Aligned: 6 rows
Threshold Bit Score: 771.756
Threshold Setting Gi: 115502411
Created: 16-Mar-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                   ####### #                 # #         
gi 1817734    549 YEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHlt 628
gi 729904     539 YEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLFKSDAAMTVAVKMLKPSAHlt 618
gi 115502411  544 YQIQWKVIEGIHGNNYVYIDPTQLPYDHQWEFPRDKLRFGKTLGSGAFGKVVEATAYGMSKADTVMTVAVKMLKPSAHat 623
gi 75570448   541 YEIQWKVVEEINGNNYVYIDPTQLPYDNKWEFPRDRLCFGKILGAGAFGKVVEATAYGLLKEDSRLTVAVKMLKPSAHst 620
gi 47219341   586 YQIQWKVIEGIHGNNYVYIDPTQLPYDHQWEFPRKNLRFGKTLGSGAFGKVVEATAYGLASADSTMTVAVKMLKSSAHst 665
gi 126331737  597 YEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLFKSDAAMTVAVKMLKPSAHlt 676
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                               # #   #                                   
gi 1817734    629 EREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICskqEDHAEAALYKNLLHSKES 708
gi 729904     619 EREALMSELKVLSYLGNHINIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICpkhEEHAEAAVYENLLHQAEP 698
gi 115502411  624 EKEALMSELKVLSYLGNHINIVNLLGACTVGGPTLVITEYCCFGDLLNFLRRRRVYFYY---TTLGEDAYYRNVMMQSEP 700
gi 75570448   621 EREALMSELKVLSYLGHHKNIVNLLGACTVGGPTLVITEYCCYGDLLNYLRRKRDSFICpkfEDNSEAALYKNLLNTRDM 700
gi 47219341   666 EKEALMSELKVLIYLGNHINIVNLLGACTVGGPTLVITEYCCFGDLLNFLRRKRESFIC---FKLEEDCHYRNVMLQREM 742
gi 126331737  677 EREALMSELKVLSYLGNHMNIVNLLGACTIGGPPLVITKNCCHGDLLNFLRKKRDSFFCskhEDHAETTLYKNLLQSKDS 756
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 1817734    709 ScsDSTNEYMDMKPG------VSYVVPTKADKRrs---vRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFL 779
gi 729904     699 Ta-DAVNEYMDMKPG------VSYAVPPKADKKrp---vKSGSYTDQDVTLSMLEDDELALDVEDLLSFSYQVAKGMSFL 768
gi 115502411  701 N--DSRNGYMTMKPS------VLGILSSENRRSl----nKGDSYSDSDAVSEILQEDGLTLDTEDLLSFSYQVAKGMDFL 768
gi 75570448   701 Gc-EGMSEYIDMKPA------VSYVVPTKTDKR------RSGSFGDQDVSVSIPEEDDLALDTEDLINFSYQVAQGMNFL 767
gi 47219341   743 Ag-DSLNGYMTMRPSaagtlsPSFSSEKKRSLRkgkhasHCSQYVEADSESEMFDEDSLSLDTEDLLSFSYQVAKGMEFL 821
gi 126331737  757 Sc-DGANEYMDMKPG------VSYVVPTKADKRrs---aRIGSYIERDVTTAIMDDDELALDIEDLLSFSYQVAKGMSFL 826
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                 #   ## #          #                 #####        #                      
gi 1817734    780 ASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELF 859
gi 729904     769 ASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGILLWELF 848
gi 115502411  769 ASKNCIHRDLAARNILLTQGRVAKICDFGLARDITTDSNYVVKGNARLPVKWMSPESIFECVYTFESDVWSYGILLWEIF 848
gi 75570448   768 ASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAPESIFHCVYTFESDVWSYGILLWEIF 847
gi 47219341   822 TSKNCIHRDLAARNILLTQGRVAKICDFGLARDINTDSNYVVKGNARLPVKWMSPESIFECVYTFESDVWSYGILLWEIF 901
gi 126331737  827 ASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELF 906
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
Feature 1                     #                                                    
gi 1817734    860 SLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQI 924
gi 729904     849 SLGSSPYPGMPVDSKFYKMIKEGYRMFSPECSPPEMYDIMKSCWDADPLQRPTFKQIVQLIEQQL 913
gi 115502411  849 SLGSSPYPGMPVDSKFYKMIKEGYRMESPEFSPSEMYDIMHSCWDADPVKRPSFSKIVEKIEQQI 913
gi 75570448   848 SLGSSPYPRIPVDSKFYKMIKDGYRMMSPECAPLEMYEIMRSCWNSDPLKRPTFKQIVQMVEQQL 912
gi 47219341   902 SLGNSPYPGMPVDAKFYKLIKEGYRMDAPEFAPSEMYQIMRSCWDADPLNRPPFRKVVERIEQQL 966
gi 126331737  907 SLGSSPYPGMPVDSKFYKMIKEGFRMLSPECAPPEMYDIMKSCWNADPLQRPTFKQIVQLIEQQL 971

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap