1OEC


Conserved Protein Domain Family
PTKc_FGFR2

?
cd05101: PTKc_FGFR2 (this model, PSSM-Id:133232 is obsolete and has been replaced by 270679)
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2
Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to more that one type of receptor. There are many splice variants of FGFR2 which show differential expression and binding to FGF ligands. Disruption of either FGFR2 or FGFR2b is lethal in mice, due to defects in the placenta or severe impairment of tissue development including lung, limb, and thyroid, respectively. Disruption of FGFR2c in mice results in defective bone and skull development. Genetic alterations of FGFR2 are associated with many human skeletal disorders including Apert syndrome, Crouzon syndrome, Jackson-Weiss syndrome, and Pfeiffer syndrome.
Statistics
?
PSSM-Id: 133232
View PSSM: cd05101
Aligned: 5 rows
Threshold Bit Score: 640.917
Threshold Setting Gi: 56553615
Created: 10-Jul-2007
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 26 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the structures of other PTK family members bound to substrate peptides and ATP analogs as well as, the structure of human FGFR2 tyr kinase bound to a 4-aryl-2-phenylamino pyrimidine inhibitor (1OEC_A ).
  • Citation:PMID 9312016

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                           # # ###   #                   # #                           
1OEC_A       13 EYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKH 92
gi 22449839 461 EYDLPEDPRWEFSRDKLTLGKPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGRH 540
gi 45384352 467 EYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDRPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKH 546
gi 544293   455 EYELPHDPMWEFSRDKLTLGKPLGEGCFGQVVMAEALGIDKERPKESVTVAVKMLKDNATEKDLADLVSEMEMMKMIGKH 534
gi 82102599 461 EYDLPEDPRWEFSRDKLTLGKPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGRH 540
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                          ##### #                                                      
1OEC_A       93 KNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIH 172
gi 22449839 541 KNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDIARVSDEPLTFKDLVSCTYQVARGMEYLASQKCIH 620
gi 45384352 547 KNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSFDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIH 626
gi 544293   535 KNIINLLGACTQGGTLYVIVEYAAKGNLRQYLRARRPLEMEYSFDVTRVPDEQMTFKDLVSCTYQIARGMEYLASQKCIH 614
gi 82102599 541 KNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDIARVSDEPLTFKDLVSCTYQVARGMEYLASQKCIH 620
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #   ## #          #                 #####        #                             
1OEC_A      173 RDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPY 252
gi 22449839 621 RDLAARNVLVTESNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPY 700
gi 45384352 627 RDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPY 706
gi 544293   615 RDLAARNVLVTENNVMKIADFGLARDVNNIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPY 694
gi 82102599 621 RDLAARNVLVTESNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPY 700
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....
Feature 1           #                                                           
1OEC_A      253 PGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEE 316
gi 22449839 701 PGIPVEELFKLLKEGHRMDKPANCTNELYMMMKDCWHAISSHRPTFKQLVEDLDRILTLATNEE 764
gi 45384352 707 PGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWQAVPSQRPTFKQLVEDLDRILTLTTNEE 770
gi 544293   695 PGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAIPSHRPTFKQLVEDLDRILTLTTNEE 758
gi 82102599 701 PGIPVEELFKLLKEGHRMDKPANCTNELYMMMKDCWHAISSHRPTFKQLVEDLDRILTLATNEE 764

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap