Conserved Protein Domain Family
PTKc_FGFR4

?
cd05099: PTKc_FGFR4 
Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Unlike other FGFRs, there is only one splice form of FGFR4. It binds FGF1, FGF2, FGF6, FGF19, and FGF23. FGF19 is a selective ligand for FGFR4. Although disruption of FGFR4 in mice causes no obvious phenotype, in vivo inhibition of FGFR4 in cultured skeletal muscle cells resulted in an arrest of muscle progenitor differentiation. FGF6 and FGFR4 are uniquely expressed in myofibers and satellite cells. FGF6/FGFR4 signaling appears to play a key role in the regulation of muscle regeneration. A polymorphism in FGFR4 is found in head and neck squamous cell carcinoma. FGFR4 is part of the FGFR subfamily, which are receptor PTKs (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to more that one type of receptor. The FGFR4 subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 133230
View PSSM: cd05099
Aligned: 4 rows
Threshold Bit Score: 697.484
Threshold Setting Gi: 90110020
Created: 10-Jul-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        ## # ## #                   # #                              
Q03142    451 LPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNI 530  house mouse
Q90330    366 LPLDSKWEFPREKLVLGKPLGEGCFGQVVRAEAYGIDRQWPDRAVTVAVKMLKDNATDKDLADLISEMEMMKLMDKHKNI 445  common quail
NP_571505 565 LPYDPDWEFPRENLTLGKPLGEGCFGQVVRAEAYGINKENQDHMATVAVKMLKDDATDKDLADLISEMELMKVMDKHKNI 644  zebrafish
Q91743    477 LPLDAKWEFPRDRLVLGKPLGEGCFGQVVRAEGYGIEKDRPEKPVTVAVKMLKDNGTDKDLSDLISEMELMKVIGKHKNI 556  African clawed frog
Feature 1                     ####  ##                                                      # 
Q03142    531 INLLGVCTQegPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYLESRKCIHRDL 610  house mouse
Q90330    446 INLLGVCTQdgPLYVIVEFAAKGNLREYLRARRPPTPDYTFDITELHEEQLCFKDLVSCVYQVARGMEYLESRRCIHRDL 525  common quail
NP_571505 645 INLLGVCTQdgPLYVLVEYASKGSLREYLRARRPPGMDYTFDVTKVPEEQLTFKDLVSCAYQVARGMEYLASKRCIHRDL 724  zebrafish
Q91743    557 INLLGVCTQegPLFVIVEYASKGNLREFLRARRPPTPEDAFDITKVPEELLSFKDLVSCAYQVARGMEYLESKRCIHRDL 636  African clawed frog
Feature 1       ## #          #                 #####        #                                
Q03142    611 AARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFEILLWEIFTLGGSPYPGI 690  house mouse
Q90330    526 AARNVLVTAENVMKIADFGLARDVHDIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILMWEIFTLGGSPYPGI 605  common quail
NP_571505 725 AARNVLVTEDNVMKIADFGLARGVHQIDYYKKTTNGRMPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGI 804  zebrafish
Q91743    637 AARNVLVAEDNVMKIADFGLARGVHDIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDIWSFGVLTWEIFTLGGSPYPVI 716  African clawed frog
Feature 1      #                                                                        
Q03142    691 PVEELFSLLREGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKVLLaVSEEYLDLRLTFGPFSPS 764  house mouse
Q90330    606 PVEELFKLLKEGHRMDCPSNCTHELYMLMRECWHAVPLQRPTFKQLVEGLDKILAaISEEYLDLSMPFEQYSPS 679  common quail
NP_571505 805 PVEELFKLLKEGHRMDKPSNCTHELYMKMRECWHAVPTQRPTFKQLVEELDRVLVsISDEYLDLSTPFEQYSPS 878  zebrafish
Q91743    717 PYEELFKLLREGHRMDKPSNCTHELYMLMRECWHAVPTQRPTFKQLEHLDRILTA-VSEEYLDLSMPFEQYSPS 789  African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap