Conserved Protein Domain Family
PTKc_FGFR4

?
cd05099: PTKc_FGFR4 
Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Unlike other FGFRs, there is only one splice form of FGFR4. It binds FGF1, FGF2, FGF6, FGF19, and FGF23. FGF19 is a selective ligand for FGFR4. Although disruption of FGFR4 in mice causes no obvious phenotype, in vivo inhibition of FGFR4 in cultured skeletal muscle cells resulted in an arrest of muscle progenitor differentiation. FGF6 and FGFR4 are uniquely expressed in myofibers and satellite cells. FGF6/FGFR4 signaling appears to play a key role in the regulation of muscle regeneration. A polymorphism in FGFR4 is found in head and neck squamous cell carcinoma. FGFR4 is part of the FGFR subfamily, which are receptor PTKs (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to more that one type of receptor. The FGFR4 subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 133230
View PSSM: cd05099
Aligned: 4 rows
Threshold Bit Score: 697.484
Threshold Setting Gi: 90110020
Created: 10-Jul-2007
Updated: 2-Mar-2014
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                          ## # ## #                   # #                              
gi 90110020 451 LPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNI 530
gi 82136081 366 LPLDSKWEFPREKLVLGKPLGEGCFGQVVRAEAYGIDRQWPDRAVTVAVKMLKDNATDKDLADLISEMEMMKLMDKHKNI 445
gi 18858679 565 LPYDPDWEFPRENLTLGKPLGEGCFGQVVRAEAYGINKENQDHMATVAVKMLKDDATDKDLADLISEMELMKVMDKHKNI 644
gi 75570435 477 LPLDAKWEFPRDRLVLGKPLGEGCFGQVVRAEGYGIEKDRPEKPVTVAVKMLKDNGTDKDLSDLISEMELMKVIGKHKNI 556
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                       ####  ##                                                      # 
gi 90110020 531 INLLGVCTQegPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYLESRKCIHRDL 610
gi 82136081 446 INLLGVCTQdgPLYVIVEFAAKGNLREYLRARRPPTPDYTFDITELHEEQLCFKDLVSCVYQVARGMEYLESRRCIHRDL 525
gi 18858679 645 INLLGVCTQdgPLYVLVEYASKGSLREYLRARRPPGMDYTFDVTKVPEEQLTFKDLVSCAYQVARGMEYLASKRCIHRDL 724
gi 75570435 557 INLLGVCTQegPLFVIVEYASKGNLREFLRARRPPTPEDAFDITKVPEELLSFKDLVSCAYQVARGMEYLESKRCIHRDL 636
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ## #          #                 #####        #                                
gi 90110020 611 AARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFEILLWEIFTLGGSPYPGI 690
gi 82136081 526 AARNVLVTAENVMKIADFGLARDVHDIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILMWEIFTLGGSPYPGI 605
gi 18858679 725 AARNVLVTEDNVMKIADFGLARGVHQIDYYKKTTNGRMPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGI 804
gi 75570435 637 AARNVLVAEDNVMKIADFGLARGVHDIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDIWSFGVLTWEIFTLGGSPYPVI 716
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
Feature 1        #                                                                        
gi 90110020 691 PVEELFSLLREGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKVLLaVSEEYLDLRLTFGPFSPS 764
gi 82136081 606 PVEELFKLLKEGHRMDCPSNCTHELYMLMRECWHAVPLQRPTFKQLVEGLDKILAaISEEYLDLSMPFEQYSPS 679
gi 18858679 805 PVEELFKLLKEGHRMDKPSNCTHELYMKMRECWHAVPTQRPTFKQLVEELDRVLVsISDEYLDLSTPFEQYSPS 878
gi 75570435 717 PYEELFKLLREGHRMDKPSNCTHELYMLMRECWHAVPTQRPTFKQLEHLDRILTA-VSEEYLDLSMPFEQYSPS 789

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap