1RJB,3G0E,1PKG,2I1M


Conserved Protein Domain Family
PTKc_PDGFR

?
cd05055: PTKc_PDGFR 
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. They are receptor PTKs (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR subfamily receptors are important in the development of a variety of cells. PDGFRs are expressed in a many cells including fibroblasts, neurons, endometrial cells, mammary epithelial cells, and vascular smooth muscle cells. PDGFR signaling is critical in normal embryonic development, angiogenesis, and wound healing. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem cells, the interstitial cells of Cajal, and the pacemaker cells of the GI tract. CSF-1R signaling is critical in the regulation of macrophages and osteoclasts. Mammalian FLT3 plays an important role in the survival, proliferation, and differentiation of stem cells. The PDGFR subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase .
Statistics
?
PSSM-Id: 133186
View PSSM: cd05055
Aligned: 8 rows
Threshold Bit Score: 582.907
Threshold Setting Gi: 82071582
Created: 10-Jul-2007
Updated: 2-Mar-2014
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 24 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:includes ATP binding and substrate binding sites
  • Comment:Based on the structures of other PTK family members bound to substrate peptides and ATP analogs, as well as the structure of human c-Kit bound to MgADP.
  • Citation:PMID 9312016

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                    ## #### #                 # #       
1RJB_A         9 YESQLQMVQVtgssdnEYFYVDFReyEYDLKWEFPRENLEFGKVLGSGAFGKVMNATAYGISktgVSIQVAVKMLKEKad 88
3G0E_A        12 YEVQWKVVEEin--gnNYVYIDPTqlPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIksdAAMTVAVKMLKPSah 89
1PKG_B         5 YEVQWKVVEEin--gnNXVXIDPTqlPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIksdAAMTVAVKMLKPSah 82
2I1M_A        12 YQVRWKIIESye--gnSYTFIDPTqlPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGkedAVLKVAVKMLKSTah 89
gi 82100806  531 YEIRWRVIESvspdghEYIYVDPMqlPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSrsqPVMKVAVKMLKPTar 610
gi 82071582  558 YEIRWKVIESvsqdghEYIYVDPIhlPYDLAWEMPRDNLVLGRTLGSGAFGRVVEATAHGLShsqSSIKVAVKMLKATar 637
gi 266418    544 YQVRWKIIERye--gnSYTFIDPTqlPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGkedAVLKVAVKMLKSTah 621
gi 1817734   549 YEVQWKVVEEin--gnNYVYIDPTqlPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIksdAAMTVAVKMLKPSah 626
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                # #   #                                 
1RJB_A        89 sseREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFsedeieyenqk---------- 158
3G0E_A        90 lteREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFicsktspa------------- 156
1PKG_B        83 lteREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFicsktspa------------- 149
2I1M_A        90 adeKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKSRVLetdpaf--------------- 154
gi 82100806  611 sseKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRESFlnpkpeksnkkeldifginpa 690
gi 82071582  638 rseTQALMSELKIMSHLGPHLNIVNLLAACTKHGPLYLVTEYCRYGDLVDYLHRNKHTFlqyyldknqddgslisggstp 717
gi 266418    622 adeKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMlgpslspgqdsegdssyknih 701
gi 1817734   627 lteREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFicskqedhaeaalyknllhsk 706
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1RJB_A       159 -----------------------------------------------------------------rleeeedlnvLTFED 173
3G0E_A       157 -------------------------------------------------------------------imeddelaLDLED 169
1PKG_B       150 -------------------------------------------------------------------imeddelaLDLED 162
2I1M_A       155 ---------------------------------------------------------------------aianstASTRD 165
gi 82100806  691 dessrsyvilsfeskgdymdmkqadnt-qyvpmleisnaskysdlqgsnydhppsqkgsndgemdqllsdnmsegLTTND 769
gi 82071582  718 lsqrkgyvsfgsesdggymdmskdepavyvpmqeqmdtikyadiqpspyespyqqdlyqeqgggrvdlvisdspaLTYDD 797
gi 266418    702 lekkyvrrdsgfs-----------------------------sqgvdtyvemrpvstsssdsffkqdldkepsrpLELWD 752
gi 1817734   707 esscsdstneymdmkp----------------------gvsyvvptkadkrrsvrigsyierdvtpaimeddelaLDLED 764
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                               #   ## #          #                 #####        #       
1RJB_A       174 LLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWMAPESLFEgIYTI 253
3G0E_A       170 LLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNcVYTF 249
1PKG_B       163 LLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNcVYTF 242
2I1M_A       166 LLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDcVYTV 245
gi 82100806  770 LLSFTYQVAKGMEFLASKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDnLYTT 849
gi 82071582  798 LLGFSYQVAKGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMHDSNYISKGSTFLPLKWMAPESIFHnLYTT 877
gi 266418    753 LLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYVVKGNARLPVKWMAPESILYcVYTV 832
gi 1817734   765 LLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNcVYTF 844
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                   #                                                    
1RJB_A       254 KSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQL 333
3G0E_A       250 ESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQI 329
1PKG_B       243 ESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQI 322
2I1M_A       246 QSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQA 325
gi 82100806  850 LSDVWSYGILLWEIFSLGGTPYPGMIVDSSFYNKIKSGYRMSKPEHAPQDVYDMMMKCWNSEPEKRPSFLGLSDTIASLL 929
gi 82071582  878 LSDVWSYGILLWEIFTLGGTPYPDLPMNELFYSPLKRGYRMAKPAHASDEVYEIMKRCWDETFEKRPDFSFLVHCVGDML 957
gi 266418    833 QSDVWSYGILLWEIFSLGLNPYPGILVNNKFYKLVKDGYQMAQPVFAPKNIYSIMQSCWDLEPTRRPTFQQICFLLQEQA 912
gi 1817734   845 ESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQI 924

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap