2C30,2BVA,2F57,2Q0N,2CDZ


Conserved Protein Domain Family
STKc_PAK_II

?
cd06648: STKc_PAK_II (this model, PSSM-Id:132979 is obsolete and has been replaced by 270815)
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase
Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs found in group I PAKs, such as an AID (autoinhibitory domain) and SH3 binding sites. Since group II PAKs do not contain an obvious AID, they may be regulated differently from group I PAKs. While group I PAKs interact with the SH3 containing proteins Nck, Grb2 and PIX, no such binding has been demonstrated for group II PAKs. Some known substrates of group II PAKs are also substrates of group I PAKs such as Raf, BAD, LIMK and GEFH1. Unique group II substrates include MARK/Par-1 and PDZ-RhoGEF. Group II PAKs play important roles in filopodia formation, neuron extension, cytoskeletal organization, and cell survival.
Statistics
?
Aligned: 11 rows
Threshold Bit Score: 528.554
Threshold Setting Gi: 103488898
Created: 3-Sep-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 37 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:The active site is composed of the ATP binding site and the substrate binding site. The substrate binding site is based on the binding of human PAK4 to a consensus peptide.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                  #####   #            # #        #                   # 
2C30_A        27 HEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGIVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVE 106 human
2BVA_A         2 HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVE 81  human
2F57_B        27 HEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEVVIMRDYHHDNVVD 106 human
2Q0N_A        11 HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVE 90  human
2CDZ_A        13 HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVE 92  human
Q9VXE5       348 HEQFRAALQMVVSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVE 427 fruit fly
ABF71876     211 DEEFRNALKFVVDGTDPRSDLTDYKQIGEGSTGVVEAAYKISTKQIVAVKRMNLRKQQRRELLFNEVSILRQYQHPNIVR 290 nematode
XP_792633    485 HEQFRSALQMVVSPGDPRYKLENFVKIGEGSTGIVCIATEASSGRQVAVKKMDLRKQQRRELLFNEVVIMRDYKHPNIVE 564 purple urchin
XP_001637909   9 HEQFRRHLEVVVQSTRQPENLGNFMKIGEGSTGIVCLATDKRTGRQVAVKKMDLKKQQRRELLFNEVVIMRDYPHPNIVE 88  starlet sea ane...
EDP36599     260 HDEFRAALKLVVLPGDPRADLTNYTQIGEGSTGTVVTAHQISTGRKIAIKKMNILKQQRRELLFNEVLIMRDYEHPNVVE 339 agent of lympha...
XP_002108660 149 HEQFKDAIRTITSKDDPRSRFDRFVKIAEGSTSIVTIAHDYKYDRKVAVKKMDLTKQQRRELLFNELAIMKDFHYANIVE 228 Trichoplax adha...
Feature 1                      ##### ##  #                                   # #### #         ## 
2C30_A       107 MYKSYLVGEELWVLMEFLQGGALTDIVSq-vRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRVKLSDF 185 human
2BVA_A        82 MYNSYLVGDELWVVMEFLEGGALTDIVTh-tRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 160 human
2F57_B       107 MYSSYLVGDELWVVMEFLEGGALTDIVTh-tRMNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDF 185 human
2Q0N_A        91 MYNSYLVGDELWVVMEFLEGGALTDIVTh-tRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 169 human
2CDZ_A        93 MYNSYLVGDELWVVMEFLEGGALTDIVTh-tRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 171 human
Q9VXE5       428 TYSSFLVNDELWVVMEYLEGGALTDIVTh-sRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDF 506 fruit fly
ABF71876     291 FFSSHLVDDELWVVMEFMEGGSLTDIVTa-tRMTEPQIATISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDF 369 nematode
XP_792633    565 MYDSFLVGDELWVVMEFLEGGALTDIVThtgRMQEEQVAYVCQAILKALAFLHSQGVIHRDIKSDSILLTHDGNVKLSDF 644 purple urchin
XP_001637909  89 MYGSHLVGDELWVVMEFLEGGTLTDIVTh-tNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDF 167 starlet sea ane...
EDP36599     340 MYGSYLVGDELWVLMEYMEGGALTDIITq-mRIDEPAIATICVQCLKALEYLHSKGVVHRDIKSDSILLTKDGVAKISDF 418 agent of lympha...
XP_002108660 229 LYDSYLVGDELWLVLEYVAGGSLTDIITq-tRIHEDQIATVCKYCLRALSFLHTHKIIHRDIKSDSVLLTSSGQVKLSDF 307 Trichoplax adha...
Feature 1         #            ##### #                          #        ###                     
2C30_A       186 GFCAQISKDVPKRKXLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFSDSPVQAMKRLRDS-PPPKLKNS 264 human
2BVA_A       161 GFCAQVSKEVPRRKXLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDN-LPPRLKNL 239 human
2F57_B       186 GFCAQVSKEVPKRKXLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDS-LPPRVKDL 264 human
2Q0N_A       170 GFCAQVSKEVPRRKXLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDN-LPPRLKNL 248 human
2CDZ_A       172 GFCAQVSKEVPRRKXLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDN-LPPRLKNL 250 human
Q9VXE5       507 GFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDM-QPPNLKNA 585 fruit fly
ABF71876     370 GFCGQLSEEVPRRRSLVGTPYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEhEARFSRHA 449 nematode
XP_792633    645 GFCAQISSDTPKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVMEMVDGEPPFFNEPPLQAMRRIRDM-PPPKLKNT 723 purple urchin
XP_001637909 168 GFCAQVTEDMPRRKSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDL-EPPTSRNP 246 starlet sea ane...
EDP36599     419 GFCGQLSVDIPQRRSLVGTPYWMSPEVISRLPYGTEADIWSLGIMVIEMVQGEPPLFNVQPLQAMKMIRDN-GPPKINEP 497 agent of lympha...
XP_002108660 308 GFCSQTSDEVPRRRSLVGTPYWMAPELIAREPYGSEVDIWSLGIMIIEMVDGEPPHFDKSPLEAMTNIRTD-KPPHFRHH 386 Trichoplax adha...
Feature 1                                                       
2C30_A       265 hkVSPVLRDFLERMLVRDPQERATAQELLDHPFLLqtGLPECLVPLI 311 human
2BVA_A       240 hkVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAkaGPPASIVPLM 286 human
2F57_B       265 hkVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKlaGPPSCIVPLM 311 human
2Q0N_A       249 hkVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAkaGPPASIVPLM 295 human
2CDZ_A       251 hkVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAkaGPPASIVPLM 297 human
Q9VXE5       586 hkVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRqaGPPSLLVPLM 632 fruit fly
ABF71876     450 k-VSVELSELLSHCIVKDVNKRWPAKDLLRHPFFAkaQHSSSIAPLL 495 nematode
XP_792633    724 hkASPRLLGFIERLLVRDPSQRASAFELLEHPFLRqcGPTSSLLPTM 770 purple urchin
XP_001637909 247 iqISPRLQSFLDNALIRDPLYRATAFELLNHPFIRnvGNSTAMQDMM 293 starlet sea anemone
EDP36599     498 vnVSPELASFISQMLVRDVKQRATASQLLNHEFLKkaCDPSVICSMM 544 agent of lymphatic filariasis
XP_002108660 387 --VSAILRSFARLMLVKQPESRATAYELLQHQFILksRNHSILKPLL 431 Trichoplax adhaerens

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap