2C30,2BVA,2F57,2Q0N,2CDZ


Conserved Protein Domain Family
STKc_PAK_II

?
cd06648: STKc_PAK_II (this model, PSSM-Id:132979 is obsolete and has been replaced by 270815)
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase
Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs found in group I PAKs, such as an AID (autoinhibitory domain) and SH3 binding sites. Since group II PAKs do not contain an obvious AID, they may be regulated differently from group I PAKs. While group I PAKs interact with the SH3 containing proteins Nck, Grb2 and PIX, no such binding has been demonstrated for group II PAKs. Some known substrates of group II PAKs are also substrates of group I PAKs such as Raf, BAD, LIMK and GEFH1. Unique group II substrates include MARK/Par-1 and PDZ-RhoGEF. Group II PAKs play important roles in filopodia formation, neuron extension, cytoskeletal organization, and cell survival.
Statistics
?
PSSM-Id: 132979
View PSSM: cd06648
Aligned: 11 rows
Threshold Bit Score: 528.554
Threshold Setting Gi: 103488898
Created: 3-Sep-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 37 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:The active site is composed of the ATP binding site and the substrate binding site. The substrate binding site is based on the binding of human PAK4 to a consensus peptide.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                  #####   #            # #        #                   # 
2C30_A        27 HEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGIVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVE 106
2BVA_A         2 HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVE 81
2F57_B        27 HEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEVVIMRDYHHDNVVD 106
2Q0N_A        11 HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVE 90
2CDZ_A        13 HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVE 92
gi 55584007  348 HEQFRAALQMVVSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVE 427
gi 103488898 211 DEEFRNALKFVVDGTDPRSDLTDYKQIGEGSTGVVEAAYKISTKQIVAVKRMNLRKQQRRELLFNEVSILRQYQHPNIVR 290
gi 115762690 485 HEQFRSALQMVVSPGDPRYKLENFVKIGEGSTGIVCIATEASSGRQVAVKKMDLRKQQRRELLFNEVVIMRDYKHPNIVE 564
gi 156397460   9 HEQFRRHLEVVVQSTRQPENLGNFMKIGEGSTGIVCLATDKRTGRQVAVKKMDLKKQQRRELLFNEVVIMRDYPHPNIVE 88
gi 158598781 260 HDEFRAALKLVVLPGDPRADLTNYTQIGEGSTGTVVTAHQISTGRKIAIKKMNILKQQRRELLFNEVLIMRDYEHPNVVE 339
gi 195997583 149 HEQFKDAIRTITSKDDPRSRFDRFVKIAEGSTSIVTIAHDYKYDRKVAVKKMDLTKQQRRELLFNELAIMKDFHYANIVE 228
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      ##### ##  #                                   # #### #         ## 
2C30_A       107 MYKSYLVGEELWVLMEFLQGGALTDIVSq-vRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRVKLSDF 185
2BVA_A        82 MYNSYLVGDELWVVMEFLEGGALTDIVTh-tRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 160
2F57_B       107 MYSSYLVGDELWVVMEFLEGGALTDIVTh-tRMNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDF 185
2Q0N_A        91 MYNSYLVGDELWVVMEFLEGGALTDIVTh-tRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 169
2CDZ_A        93 MYNSYLVGDELWVVMEFLEGGALTDIVTh-tRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF 171
gi 55584007  428 TYSSFLVNDELWVVMEYLEGGALTDIVTh-sRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDF 506
gi 103488898 291 FFSSHLVDDELWVVMEFMEGGSLTDIVTa-tRMTEPQIATISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDF 369
gi 115762690 565 MYDSFLVGDELWVVMEFLEGGALTDIVThtgRMQEEQVAYVCQAILKALAFLHSQGVIHRDIKSDSILLTHDGNVKLSDF 644
gi 156397460  89 MYGSHLVGDELWVVMEFLEGGTLTDIVTh-tNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDF 167
gi 158598781 340 MYGSYLVGDELWVLMEYMEGGALTDIITq-mRIDEPAIATICVQCLKALEYLHSKGVVHRDIKSDSILLTKDGVAKISDF 418
gi 195997583 229 LYDSYLVGDELWLVLEYVAGGSLTDIITq-tRIHEDQIATVCKYCLRALSFLHTHKIIHRDIKSDSVLLTSSGQVKLSDF 307
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #            ##### #                          #        ###                     
2C30_A       186 GFCAQISKDVPKRKXLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFSDSPVQAMKRLRDS-PPPKLKNS 264
2BVA_A       161 GFCAQVSKEVPRRKXLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDN-LPPRLKNL 239
2F57_B       186 GFCAQVSKEVPKRKXLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDS-LPPRVKDL 264
2Q0N_A       170 GFCAQVSKEVPRRKXLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDN-LPPRLKNL 248
2CDZ_A       172 GFCAQVSKEVPRRKXLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDN-LPPRLKNL 250
gi 55584007  507 GFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDM-QPPNLKNA 585
gi 103488898 370 GFCGQLSEEVPRRRSLVGTPYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEhEARFSRHA 449
gi 115762690 645 GFCAQISSDTPKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVMEMVDGEPPFFNEPPLQAMRRIRDM-PPPKLKNT 723
gi 156397460 168 GFCAQVTEDMPRRKSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDL-EPPTSRNP 246
gi 158598781 419 GFCGQLSVDIPQRRSLVGTPYWMSPEVISRLPYGTEADIWSLGIMVIEMVQGEPPLFNVQPLQAMKMIRDN-GPPKINEP 497
gi 195997583 308 GFCSQTSDEVPRRRSLVGTPYWMAPELIAREPYGSEVDIWSLGIMIIEMVDGEPPHFDKSPLEAMTNIRTD-KPPHFRHH 386
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
Feature 1                                                       
2C30_A       265 hkVSPVLRDFLERMLVRDPQERATAQELLDHPFLLqtGLPECLVPLI 311
2BVA_A       240 hkVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAkaGPPASIVPLM 286
2F57_B       265 hkVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKlaGPPSCIVPLM 311
2Q0N_A       249 hkVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAkaGPPASIVPLM 295
2CDZ_A       251 hkVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAkaGPPASIVPLM 297
gi 55584007  586 hkVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRqaGPPSLLVPLM 632
gi 103488898 450 k-VSVELSELLSHCIVKDVNKRWPAKDLLRHPFFAkaQHSSSIAPLL 495
gi 115762690 724 hkASPRLLGFIERLLVRDPSQRASAFELLEHPFLRqcGPTSSLLPTM 770
gi 156397460 247 iqISPRLQSFLDNALIRDPLYRATAFELLNHPFIRnvGNSTAMQDMM 293
gi 158598781 498 vnVSPELASFISQMLVRDVKQRATASQLLNHEFLKkaCDPSVICSMM 544
gi 195997583 387 --VSAILRSFARLMLVKQPESRATAYELLQHQFILksRNHSILKPLL 431

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap