Conserved Protein Domain Family
STKc_MAP4K5

?
cd06646: STKc_MAP4K5 (this model, PSSM-Id:132977 is obsolete and has been replaced by 270813)
Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5
Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated either by a small GTP-binding protein or by an adaptor protein, which transmits the signal either directly to a MAP3K to start the triple kinase core cascade or indirectly through a mediator kinase, a MAP4K. MAP4K5, also called germinal center kinase-related enzyme (GCKR), has been shown to activate the MAPK c-Jun N-terminal kinase (JNK). MAP4K5 also facilitates Wnt signaling in B cells, and may therefore be implicated in the control of cell fate, proliferation, and polarity.
Statistics
?
PSSM-Id: 132977
View PSSM: cd06646
Aligned: 4 rows
Threshold Bit Score: 582.762
Threshold Setting Gi: 118092341
Created: 22-Aug-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:The active site is composed of the ATP binding site and the substrate binding site. The substrate binding site is based on the binding of human PAK4 to a consensus peptide.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                        #####   #            # #                            #           
gi 30316147   10 DILRRNPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREK 89
gi 118092341   7 DIMRRNPQQDYELIQRVGSGTYGDVYKARNLHTGELAAVKIIKLEPGDDFSLIQQEIYMVKECKHCNIVAYFGSYLSREK 86
gi 51258365    6 DILRKNPQHDYELIQRVGSGTYGDVYKARNLQTGELAAVKIIKLEQGDDFSLIQQEIFMVKECKHANIVAYFGSYLSREK 85
gi 42415535   10 EIQRRNPQHDFELIQRVGSGTYGDVYKARKISTGELAAVKIIKLEPGDDFSIIQQEIFMVKECTHHNIVAYFGSYLCREK 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            ####  ##  #                                   # #### #          #  #        
gi 30316147   90 LWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATI 169
gi 118092341  87 LWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLAYLHMKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATI 166
gi 51258365   86 LWICMEYCGGGSLQDIYHVTGPLAECQIAYMCRETLQGLAYLHSRAKMHRDIKGANILLTDNGDVKLADFGVAAKITATI 165
gi 42415535   90 LWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLGYLHSKGKMHRDIKGANILLTDNGDVKLADFGVAAKITATM 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             #### #                             #        #                              
gi 30316147  170 AKRKSFIGTPYWMAPEVAAVEKNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSST 249
gi 118092341 167 AKRKSFIGTPYWMAPEVAAVEKNGGYNQLCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSNFQPPKLKEKAKWSST 246
gi 51258365  166 AKRKSFIGTPYWMAPEVAAVEKNGGYNQLCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSSFQPPKLKEKLKWSPN 245
gi 42415535  170 AKRKSFIGTPYWMAPEVAAVEKNGGYNHLCDIWAVGITSIELAELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSTA 249
                        250       260
                 ....*....|....*....|....*..
Feature 1                                   
gi 30316147  250 FHNFVKIALTKNPKKRPTAERLLTHTF 276
gi 118092341 247 FHNFVKIALTKNPKKRPTADRLLAHSF 273
gi 51258365  246 FHNFVKVSLIKNPKKRPPAERLLTHQF 272
gi 42415535  250 FHNFVKLSLTKNPKRRPTAEKMLSHLF 276

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap