Conserved Protein Domain Family
STKc_MAP4K3

?
cd06645: STKc_MAP4K3 (this model, PSSM-Id:132976 is obsolete and has been replaced by 270812)
Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3
Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated either by a small GTP-binding protein or by an adaptor protein, which transmits the signal either directly to a MAP3K to start the triple kinase core cascade or indirectly through a mediator kinase, a MAP4K. MAP4K3 plays a role in the nutrient-responsive pathway of mTOR (mammalian target of rapamycin) signaling. MAP4K3 is required in the activation of S6 kinase by amino acids and for the phosphorylation of the mTOR-regulated inhibitor of eukaryotic initiation factor 4E. mTOR regulates ribosome biogenesis and protein translation, and is frequently deregulated in cancer.
Statistics
?
PSSM-Id: 132976
Aligned: 3 rows
Threshold Bit Score: -1
Created: 22-Aug-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:The active site is composed of the ATP binding site and the substrate binding site. The substrate binding site is based on the binding of human PAK4 to a consensus peptide.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        #####   #            # #                            #           
Q8IVH8         6 DLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDK 85  human
NP_001123819   6 DLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHTNIVAYFGSYLRRDK 85  western clawed ...
XP_001921635   6 DLSRRNPQEDFELIQRIGSGTYGDVYKARNVSTGELAAIKVIKLEPGEDFDVVQQEIIMMKDCKHSNIVAYFGSYLRRDK 85  zebrafish
NP_001123819   6 DLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHTNIVAYFGSYLRRDK 85  western clawed ...
XP_001921635   6 DLSRRNPQEDFELIQRIGSGTYGDVYKARNVSTGELAAIKVIKLEPGEDFDVVQQEIIMMKDCKHSNIVAYFGSYLRRDK 85  zebrafish
Feature 1            ####  ##  #                                   # #### #          #  #        
Q8IVH8        86 LWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTdnGHVKLADFGVSAQITATI 165 human
NP_001123819  86 LWICMEFCGGGSLQDIYHVTGPLSEQQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTdnGHVKLADFGVSAQITATI 165 western clawed ...
XP_001921635  86 LWISMEYCGGGSLQDIYHVTGPLSESQIAYVCRETLQGVYYLHNKGKIHRDIKGANILLTdnGYVKLADFGVSAQISATL 165 zebrafish
NP_001123819  86 LWICMEFCGGGSLQDIYHVTGPLSEQQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTdnGHVKLADFGVSAQITATI 165 western clawed ...
XP_001921635  86 LWISMEYCGGGSLQDIYHVTGPLSESQIAYVCRETLQGVYYLHNKGKIHRDIKGANILLTdnGYVKLADFGVSAQISATL 165 zebrafish
Feature 1             #### #                             #        #                              
Q8IVH8       166 AKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNS 245 human
NP_001123819 166 AKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNS 245 western clawed ...
XP_001921635 166 AKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWAVGITAIELAELEPPMFDLHPMRALFLMTKSSFQPPKLKDKVKWTNN 245 zebrafish
NP_001123819 166 AKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNS 245 western clawed ...
XP_001921635 166 AKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWAVGITAIELAELEPPMFDLHPMRALFLMTKSSFQPPKLKDKVKWTNN 245 zebrafish
Feature 1                                   
Q8IVH8       246 FHHFVKMALTKnPKKRPTAEKLLQHPF 272 human
NP_001123819 246 FHHFIKMALTKnPKKRPTAEKLLQHPF 272 western clawed frog
XP_001921635 246 FHHFVKMALTKnPKKRPTADRLLQHPF 272 zebrafish
NP_001123819 246 FHHFIKMALTKnPKKRPTAEKLLQHPF 272 western clawed frog
XP_001921635 246 FHHFVKMALTKnPKKRPTADRLLQHPF 272 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap