Conserved Protein Domain Family
STKc_myosinIIIA_N

?
cd06638: STKc_myosinIIIA_N 
N-terminal Catalytic domain of the Serine/Threonine Kinase, Class IIIA myosin
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. Class IIIA myosin is highly expressed in retina and in inner ear hair cells. It is localized to the distal ends of actin-bundled structures. Mutations in human myosin IIIA are responsible for progressive nonsyndromic hearing loss. Human myosin IIIA possesses ATPase and kinase activities, and the ability to move actin filaments in a motility assay. It may function as a cellular transporter capable of moving along actin bundles in sensory cells. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 132969
View PSSM: cd06638
Aligned: 3 rows
Threshold Bit Score: 646.299
Threshold Setting Gi: 45387587
Created: 15-Nov-2007
Updated: 2-Mar-2014
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                  #####   #            # #                            #  
gi 160112826    2 FPLIGKTIIFDnFPDPSDTWEITETIGKGTYGKVFKVLNKKnGQKAAVKILDPIHDIDEEIEAEYNILKALSDHPNVVRF 81
gi 45387587     2 FPRSGKSIIFDsFPDPSDTWEIIETIGKGTYGKVYKVHNKVdGSKAAVKILDPIHDIDEEIEAEYNILKALSDHPNVVKF 81
gi 363729656    2 LPLTGKTIVFDsFPDPSDTWEIIETIGKGTYGKVFKVLNKKnGSKAAVKILDPVHDIDEEIEAEYNILKALSDHPNVVKF 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                           ####  ##  #                                       # #### #    
gi 160112826   82 YGIYFKKDkvnGDKLWLVLELCsGGSVTDLVKGFLKRGeRMSEPLIAYILHEALMGLQHLHNNKTIHRDVKGNNILLTte 161
gi 45387587    82 FGMFYKKDvktGDQLWLVLELCnGGSVTDLAKGMLKRGdRMEEPIIAFILHEALMGLQHLHVNKTIHRDVKGNNILLTtg 161
gi 363729656   82 YGMYYKKDvknGDQLWLVLELCnGGSVTDLVKGFLKRGeRMNELIIAYILHEALMGLQHLHENKTIHRDIKGNNILLTte 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              ##  #             #### #                               #        #          
gi 160112826  162 GGVKLVDFGVSAQLTSTRHRRNTSVGTPFWMAPEVIACEQqldtTYDARCDTWSLGITAIELGDGDPPLADLHPMRALFK 241
gi 45387587   162 GGIKLVDFGVSAQLTNTRLRRNTSVGTPFWMAPEVIACEQqldsTYDERCDVWSLGITAIELGDGDPPLAELHPMRALFK 241
gi 363729656  162 GGVKLVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQqldsSYDARCDAWSLGITAIELGDGDPPLADLHPMRALFK 241
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
Feature 1                                                       
gi 160112826  242 IPRNPPPKLRQPELWSAEFNDFISKCLTKDYEKRPTVSELLQHKFI 287
gi 45387587   242 IPRNPPPTLHQPELWSNDFNDFIRKCLIKDFELRPNVLDLLQHVFI 287
gi 363729656  242 IPRNPPPTLQQPELWSSEFNDFINKCLTKDYEKRPTVSSLLQHDFI 287

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap