Conserved Protein Domain Family
STKc_myosinIIIA_N

?
cd06638: STKc_myosinIIIA_N 
N-terminal Catalytic domain of the Serine/Threonine Kinase, Class IIIA myosin
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. Class IIIA myosin is highly expressed in retina and in inner ear hair cells. It is localized to the distal ends of actin-bundled structures. Mutations in human myosin IIIA are responsible for progressive nonsyndromic hearing loss. Human myosin IIIA possesses ATPase and kinase activities, and the ability to move actin filaments in a motility assay. It may function as a cellular transporter capable of moving along actin bundles in sensory cells. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 132969
View PSSM: cd06638
Aligned: 3 rows
Threshold Bit Score: 646.299
Threshold Setting Gi: 45387587
Created: 15-Nov-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                               #####   #            # #                            #  
Q8NEV4       2 FPLIGKTIIFDnFPDPSDTWEITETIGKGTYGKVFKVLNKKnGQKAAVKILDPIHDIDEEIEAEYNILKALSDHPNVVRF 81   human
NP_991142    2 FPRSGKSIIFDsFPDPSDTWEIIETIGKGTYGKVYKVHNKVdGSKAAVKILDPIHDIDEEIEAEYNILKALSDHPNVVKF 81   zebrafish
XP_418597    2 LPLTGKTIVFDsFPDPSDTWEIIETIGKGTYGKVFKVLNKKnGSKAAVKILDPVHDIDEEIEAEYNILKALSDHPNVVKF 81   chicken
Feature 1                        ####  ##  #                                       # #### #    
Q8NEV4      82 YGIYFKKDkvnGDKLWLVLELCsGGSVTDLVKGFLKRGeRMSEPLIAYILHEALMGLQHLHNNKTIHRDVKGNNILLTte 161  human
NP_991142   82 FGMFYKKDvktGDQLWLVLELCnGGSVTDLAKGMLKRGdRMEEPIIAFILHEALMGLQHLHVNKTIHRDVKGNNILLTtg 161  zebrafish
XP_418597   82 YGMYYKKDvknGDQLWLVLELCnGGSVTDLVKGFLKRGeRMNELIIAYILHEALMGLQHLHENKTIHRDIKGNNILLTte 161  chicken
Feature 1           ##  #             #### #                               #        #          
Q8NEV4     162 GGVKLVDFGVSAQLTSTRHRRNTSVGTPFWMAPEVIACEQqldtTYDARCDTWSLGITAIELGDGDPPLADLHPMRALFK 241  human
NP_991142  162 GGIKLVDFGVSAQLTNTRLRRNTSVGTPFWMAPEVIACEQqldsTYDERCDVWSLGITAIELGDGDPPLAELHPMRALFK 241  zebrafish
XP_418597  162 GGVKLVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQqldsSYDARCDAWSLGITAIELGDGDPPLADLHPMRALFK 241  chicken
Feature 1                                                    
Q8NEV4     242 IPRNPPPKLRQPELWSAEFNDFISKCLTKDYEKRPTVSELLQHKFI 287  human
NP_991142  242 IPRNPPPTLHQPELWSNDFNDFIRKCLIKDFELRPNVLDLLQHVFI 287  zebrafish
XP_418597  242 IPRNPPPTLQQPELWSSEFNDFINKCLTKDYEKRPTVSSLLQHDFI 287  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap