Conserved Protein Domain Family
STKc_TNIK

?
cd06637: STKc_TNIK (this model, PSSM-Id:132968 is obsolete and has been replaced by 270807)
Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase
Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activates the c-Jun N-terminal kinase (JNK) pathway and plays a role in regulating the actin cytoskeleton.
Statistics
?
PSSM-Id: 132968
View PSSM: cd06637
Aligned: 4 rows
Threshold Bit Score: 572.426
Threshold Setting Gi: 80476239
Created: 15-Nov-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:The active site is composed of the ATP binding site and the substrate binding site. The substrate binding site is based on the binding of human PAK4 to a consensus peptide.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      #####   #            # #                            #              
gi 29840818    18 LRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGM 97
gi 80476239    18 LRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGM 97
gi 59862135    18 LRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKAEINMLKKYSHHRNIATYYGAFIKKNPPGM 97
gi 118095294   14 SSDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGM 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                ####  ##  #                                     # #### #          #  #   
gi 29840818    98 DDQLWLVMEFCgAGSVTDLIKNTkgntLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQ 177
gi 80476239    98 DDQLWLVMEFCgAGSVTDLIKNTkgntLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQ 177
gi 59862135    98 DDQLWLVMEFCgAGSVTDLIKNTkgnsLKEEWTAYICREILRGLTHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQ 177
gi 118095294   94 DDQLWLVMEFCgAGSVTDLIKNTkgntLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQ 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   #### #                               #        #                       
gi 29840818   178 LDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKK 257
gi 80476239   178 LDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKK 257
gi 59862135   178 LDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKK 257
gi 118095294  174 LDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKK 253
                         250       260       270
                  ....*....|....*....|....*....|..
Feature 1                                         
gi 29840818   258 WSKKFQSFIESCLVKNHSQRPATEQLMKHPFI 289
gi 80476239   258 WSKKFQSFIDSCLVKNHSQRPTTDQLMKHPFI 289
gi 59862135   258 WSKKFQSFIESCLVKNHNQRPSTEQLIKHPFI 289
gi 118095294  254 WSKKFQSFIESCLVKNHSQRPTTEQLMKHPFI 285

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap