Conserved Protein Domain Family
STKc_TAO1

?
cd06635: STKc_TAO1 (this model, PSSM-Id:132966 is obsolete and has been replaced by 270805)
Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1
Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuronal apoptosis. TAO1 interacts with the checkpoint proteins BubR1 and Mad2, and plays an important role in regulating mitotic progression, which is required for both chromosome congression and checkpoint-induced anaphase delay. TAO1 may play a role in protecting genomic stability.
Statistics
?
PSSM-Id: 132966
View PSSM: cd06635
Aligned: 3 rows
Threshold Bit Score: 642.524
Threshold Setting Gi: 74759012
Created: 15-Nov-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:The active site is composed of the ATP binding site and the substrate binding site. The substrate binding site is based on the binding of human PAK4 to a consensus peptide.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                         #####   #            # #                        
gi 74759012     2 PSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKWQDIIKEVKFLQ 81
gi 118100308    2 PSTSRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSNEKWQDIIKEVKFLQ 81
gi 147901069    2 PSTSRAGSLKDPDVAELFFRDDPEKLFSDLREIGHGSFGAVYFAHDARTSEVVAIKKMSYSGKQSNEKWQDIIKEVKFLQ 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                #               #### ##  #                                    # #### #   
gi 74759012    82 RIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTE 161
gi 118100308   82 RIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHNMIHRDIKAGNILLTE 161
gi 147901069   82 RIQHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEIEIAAITHGALQGLAYLHSHNLIHRDIKAGNILLTE 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                #  #         #### #                             #        #               
gi 74759012   162 PGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNE 241
gi 118100308  162 PGQVKLADFGSASIASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNE 241
gi 147901069  162 PGQVKLADFGSASIVSPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCVELAERKPPLFNMNAMSALYHIAQNE 241
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
Feature 1                                                                                 #    
gi 74759012   242 SPTLQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIFVLRERPETVLIDLIQRTKDAVRELDNLQYRKMKKLLFQ 318
gi 118100308  242 SPTLQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHMFVLRERPETVLIDLIQRTKDAVRELDNLQYRKMKKLLFQ 318
gi 147901069  242 SPTLQSTEWSDYFRNFVDSCLHKIPQDRPTSDELLKHMFVLRERPETVLIDLIQRTKDAVRELDNLQYRKMKKLLFQ 318

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap