1U5R,1U5Q,2GCD


Conserved Protein Domain Family
STKc_TAO2

?
cd06634: STKc_TAO2 (this model, PSSM-Id:132965 is obsolete and has been replaced by 270804)
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2
Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. TAO2 contains a long C-terminal extension with autoinhibitory segments. It is activated by the release of this inhibition and the phosphorylation of its activation loop serine. TAO2 functions as a regulator of actin cytoskeletal and microtubule organization. In addition, it regulates the transforming growth factor-activated kinase 1 (TAK1), which is a MAPKKK that plays an essential role in the signaling pathways of tumor necrosis factor (TNF), interleukin 1 (IL-1), and Toll-like receptor (TLR).
Statistics
?
PSSM-Id: 132965
View PSSM: cd06634
Aligned: 5 rows
Threshold Bit Score: 615.137
Threshold Setting Gi: 56554141
Created: 15-Nov-2007
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 32 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:The active site is composed of the ATP binding site and the substrate binding site. The substrate binding site is based on the binding of human PAK4 to a consensus peptide.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                               #####   #            # #                               #  
1U5R_B         40 DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQY 119
1U5Q_A         40 DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQY 119
2GCD_A          1 DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQY 80
gi 148234933   12 DPEVAELFFKDDPEKLFADLREIGHGSFGAVYFARDIRNNEVVAIKKMSYSGKQSNEKWQDIIKEVKFLQKLRHPNTIEY 91
gi 47210310    12 DPEVADLFCKDDPEKLFADLREIGHGSFGAVYFARDVRSNEVVAIKKMSYSGKQTNEKWQDIIKEVKFLQKLRHPNTIEY 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      #### ##  #                                    # #### #          #  
1U5R_B        120 RGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFG 199
1U5Q_A        120 RGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFG 199
2GCD_A         81 RGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFG 160
gi 148234933   92 KGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEMEIAAITHGALQGLAYLHNHNMIHRDVKAGNILLTEPGLVKLGDFG 171
gi 47210310    92 RGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQEIEIAAITHGALQGLAYLHSHNMIHRDVKAGNILLTEPGQVKLGDFG 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #         #### #                             #          #                       
1U5R_B        200 SASIMAPANXFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELA--ERKPPLFNMNAMSALYHIAQNESPALQSGH 277
1U5Q_A        200 SASIMAPANXFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELA--ERKPPLFNMNAMSALYHIAQNESPALQSGH 277
2GCD_A        161 SASIMAPANXFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELA--ERKPPLFNMNAMSALYHIAQNESPALQSGH 238
gi 148234933  172 SASIMAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITSIELA--ERKPPLFNMNAMSALYHIAQNESPVLQSNH 249
gi 47210310   172 SASIVSPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELGvsERKPPLFNMNAMSALYHIAQNESPILQSNQ 251
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                         #     
1U5R_B        278 WSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQE 347
1U5Q_A        278 WSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQE 347
2GCD_A        239 WSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQE 308
gi 148234933  250 WSEYFRNFVDSCLQKIPQDRPTSDMLLKHRFLQRERPQTVIMELIQRTKDAVRELDNLQYRKMKKILFQD 319
gi 47210310   252 WSDSFRNFVDSSLQKIPQDRPTSDVLLNHRFLCRERPLTVIMDLIARTKDAVRELDNLQYRKMKKILFQE 321

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap