1U5R,2GCD


Conserved Protein Domain Family
STKc_TAO

?
cd06607: STKc_TAO (this model, PSSM-Id:132938 is obsolete and has been replaced by 270784)
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins
Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily members, named TAO1, TAO2, and TAO3.
Statistics
?
PSSM-Id: 132938
View PSSM: cd06607
Aligned: 8 rows
Threshold Bit Score: 599.486
Threshold Setting Gi: 1176656
Created: 21-Aug-2006
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 32 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:The active site is composed of the ATP binding site and the substrate binding site. The substrate binding site is based on the binding of human PAK4 to a consensus peptide.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                               #####   #            # #                               #  
1U5R_B         40 DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQY 119
2GCD_A          1 DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQY 80
gi 1176656     14 DPSIAALFSNKDPEQRYQDLREIGHGSFGAVYFAYDKKNEQTVAIKKMNFSGKQAVEKWNDILKEVSFLNTVVHPHIVDY 93
gi 74759012    12 DPEIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKWQDIIKEVKFLQRIKHPNSIEY 91
gi 78099182     8 DPEIADLFYKDDPEEIFVGLHEIGHGSFGAVYFATNSHTNEVVAVKKMSYSGKQTNEKWQDIIKEVKFLQQLKHPNTIEY 87
gi 24643296    11 DPEIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEY 90
gi 72100694    12 DLEVQRLFSDEDPEKLFTGMTEIGHGSFGAVYHATNTITGEVVAIKKMLYNGKSSTEKWQDIIKEVRFIHRVRNANCIEF 91
gi 156394081   11 NAEYAGLFDDHDPEKIYADLREIGHGSFGAVYYARNVRTNEVVAIKKMSYSGKQSQEKWQDIVKEVKFLKQCNHRNTISY 90
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      #### ##  #                                    # #### #          #  
1U5R_B        120 RGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFG 199
2GCD_A         81 RGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFG 160
gi 1176656     94 KACFLKDTTCWLVMEYCIGSAADIVDVLRKGMREVEIAAICSQTLDALRYLHSLKRIHRDIKAGNILLSDHAIVKLADFG 173
gi 74759012    92 KGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFG 171
gi 78099182    88 KGCYLKEHTAWLVMEYCLGSASDMLEVHKKPLQEVEIAAITHGALQGLAYLHSHCKIHRDIKAGNILLTEPGQVKLADFG 167
gi 24643296    91 KGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFG 170
gi 72100694    92 KGCYLREHTAWLAMEYCLGSASDVLDVHKKPLQEDEIAAVCEGALQGLEYLHNYETIHRDIKAANILLTEHGTVKLGDFG 171
gi 156394081   91 KACHIKEHTAWLVMEYCLGSASDILEVHKKPLQELEIAAICADSLQGLHYLHSHEKIHRDVKAGNVLLTEDGTVKLADFG 170
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #         #### #                             #        #                         
1U5R_B        200 SASIMAPANXFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGh-- 277
2GCD_A        161 SASIMAPANXFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGh-- 238
gi 1176656    174 SASLVDPAQTFIGTPFFMAPEVILAMDEGHYTDRADIWSLGITCIELAERRPPLFSMNAMSALYHIAQNDPPTLSPIdts 253
gi 74759012   172 SASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPTLQSNe-- 249
gi 78099182   168 SASIVSPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNDSPTLQSNe-- 245
gi 24643296   171 SAAIKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNd-- 248
gi 72100694   172 SASLVNPANSFVGTPFWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNDPPSLSTSg-- 249
gi 156394081  171 SAALCSPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLFNMNAMSALYHIAQNDPPSLSTDg-- 248
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
Feature 1                                                                             #    
1U5R_B        278 ----WSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNlQYRKMKKILFQ 346
2GCD_A        239 ----WSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNlQYRKMKKILFQ 307
gi 1176656    254 eqpeWSLEFVQFIDKCLRKPAEERMSAEECFRHPFIQRSRPSDTIQELIQRTKNMVLELDNfQYKKMRKLMYL 326
gi 74759012   250 ----WSDYFRNFVDSCLQKIPQDRPTSEELLKHIFVLRERPETVLIDLIQRTKDAVRELDNlQYRKMKKLLFQ 318
gi 78099182   246 ----WSDSFRGFVDYCLQKIPQERPSSADLLRHDFVRRDRPPRVLIDLIQRTKDAVRELDNlQYRKMKKILFQ 314
gi 24643296   249 ----WSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELIARTKSAVRELDNlNYRKMKKILMV 317
gi 72100694   250 ----WNQCFHDFIKACLAKEPDSRPSARHLLQLEFVTRDRPNNTLIDLIEKTRKVVRGMDN-KNVGRIAQLFK 317
gi 156394081  249 ----WSQDFIKFVQLCLQKHPLDRPDAEQLIKHCFVSQKRPPNIIKDLIRRTKAAVRALDNmNYRKMKKMIMS 317

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap