1PDU


Conserved Protein Domain Family
NR_LBD_DHR38_like

?
cd07072: NR_LBD_DHR38_like 
Click on image for an interactive view with Cn3D
Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily
The ligand binding domain of nuclear receptor DHR38_like proteins: DHR38 is a member of the steroid receptor superfamily in Drosophila. DHR38 interacts with the USP component of the ecdysone receptor complex, suggesting that DHR38 might modulate ecdysone-triggered signals in the fly, in addition to the ECR/USP pathway. At least four differentially expressed mRNA isoforms have been detected during development. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR38 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132757
View PSSM: cd07072
Aligned: 6 rows
Threshold Bit Score: 446.195
Threshold Setting Gi: 215504293
Created: 11-Dec-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
heterodimerputative
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:heterodimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #  #  ##  #                                                                  
1PDU_A        11 GAISLITALVRSHVDTTPDPSCLDYSHYEeqs-------mseADKVQQFYQLLTSSVDVIKQFAEKIPGYfDLLPEDQEL 83
gi 210110653 311 PPVSLITALVRAHVDSSPSPPTLNYNLQFkmpgeegespksdTERVQQFYDLLCSSIEVIRTWAEKIPGFpDLLKEDQEL 390
gi 110762206 549 SPVSLITALVRAHLDTTPDQASLDYSQYRqpspgd--ppiteAEKTQQFYNLLTTSIDVIRTFADKIPGFtDLVREDQEL 626
gi 193712543 489 PPVSLITAIVRAHVDTNPDFSSLDYSQYHepkpfe--pliteAEKIQQFFGLLTTSVEVIRHFAEKIPGFkTLCKSDQDL 566
gi 215504293 356 PPVSLITALVRAHVDTSPDLVNRDYSSVSerallr--lllrtASEVQQFYSLLTSSVDYIKAFSEKIPGFsELDRSDQEL 433
gi 1708293   122 PPISLITALVRAHVDTSPDFANLDYSQYRepsple--ppmsdLEVIQQFYSLLTTSIDMIKLFAEKVPGYgDLCPEDREQ 199
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                      #                 
1PDU_A        84 LFQSASLELFVLRLAYRARIDDTKLIFCNGTVLHRTQCLRSFGEWLNDIMEFSRSLHNLEIDISAFACLCALTLITERHG 163
gi 210110653 391 LFQSACLELFVLRLAYRSAPSEERLVFCNGAVLHQQQCVRSFGEWINYIMEFSKSLHAMNVDISAFACMAALVLITERHG 470
gi 110762206 627 LFQSASLELFVLRLAYRTKPEDTKLTFCNGVVLALEQCQRSFGDWLHSILEFSKALHILDVDASAFACLCALTLVTARYG 706
gi 193712543 567 LFQSASLELFVLRLAYRTKYADTKLIFCNGVVLDKQQCHRSFGDWLQAILDFSQSLHSLDIDISSFSCLCALTLITERHG 646
gi 215504293 434 LFQSASLELFALRLAYRIRQDDDEFTFCNGVVLHRSQCERIFGDWLGAIFEFSQSLHAMQIDISAFACLAALTLVTERHG 513
gi 1708293   200 LFASARLELFVLRLAYRTALEDTKLTFSNGSVLDKRQCQRSFGDWLHAVLDFSNTSYSMDIDISTFACLCALTLITDRHG 279
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                           #   #                                                        
1PDU_A       164 LREPKKVEQLQMKIIGSLRDHVTYNaeaq-kkqHYFSRLLGKLPELRSLSVQGLQRIFYLKLEDLVPAPALIENMFVTTL 242
gi 210110653 471 LKEPEKVEELQNKIISSLRDHVTYNvhaq-nrpHYFSKLLVKLPELRTLSVQGLQRIFYLKLEDLLPTPPMIDNLFLDTL 549
gi 110762206 707 LKEPHRMEQLQSKIISSLRDHVTYNaeaq-rkaHYLSRLLGKLPELRSLSVQGLQRIFYLKLEDLVPAPPMIETMFVGSL 785
gi 193712543 647 LREAKKTEQIQMKIITSLREHIAYSmsdsqrksYYFSRLLAKLTELRSLSLQGLQRIFYLKLEDLVPAPPLIENMFIASL 726
gi 215504293 514 LKDCAKVEQLQMKIVSSLRDHVTYNseaq-kkpHYFSRLLAKLPDLRSLSLQGLQRIFYLKLEELVPAPAVIENMFVSSL 592
gi 1708293   280 LKEPHRVEQVQMKIIGCLRGHMPGGggss-sgaAPLQRVLGALPELRSLSVKASQRIFYLKLEDLVPAPPLIENMFRASL 358

                 ..
Feature 1          
1PDU_A       243 PF 244
gi 210110653 550 PF 551
gi 110762206 786 PF 787
gi 193712543 727 PF 728
gi 215504293 593 PF 594
gi 1708293   359 PF 360

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap