1OVL,1OVL


Conserved Protein Domain Family
NR_LBD_Nurr1

?
cd07071: NR_LBD_Nurr1 
Click on image for an interactive view with Cn3D
The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors
The ligand binding domain of nuclear receptor Nurr1: Nurr1 belongs to the conserved family of nuclear receptors. It is a transcription factor that is expressed in the embryonic ventral midbrain and is critical for the development of dopamine (DA) neurons. Structural studies have shown that the ligand binding pocket of Nurr1 is filled by bulky hydrophobic residues, making it unable to bind to ligands. Therefore, it belongs to the class of orphan receptors. However, Nurr1 forms heterodimers with RXR and can promote signaling via its partner, RXR. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, Nurr1 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132756
View PSSM: cd07071
Aligned: 6 rows
Threshold Bit Score: 478.756
Threshold Setting Gi: 154147678
Created: 11-Dec-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
heterodimerputative
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:heterodimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                 #  #  #                                                                
1OVL_A        34 PVSLISALVRAHVDSNPAMTSLDYSRFQAnpdyqmsgDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFaDLPKADQDLLFE 113
1OVL_B        34 PVSLISALVRAHVDSNPAMTSLDYSRFQAnpdyqmsgDDTQHIQQFYDLLTGSXEIIRGWAEKIPGFaDLPKADQDLLFE 113
gi 118093899 361 PVSLISALVRAHVDSNPAMTSLDYSRFQAnpdyqmsgDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFtDLPKTDQDLLFE 440
gi 154147678 354 PVSLISALVRAHVDSNPAVSSLDYSRFQAnpeyqmngDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFsELHKQDQDLLFE 433
gi 164698468 361 PVSLISALVRAHVDSNPSMNSLDYTRFQAnpdyqlsgDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFtDLPKPDQDLLFE 440
gi 47060285  354 PVNLLNALVRAHIDSNPSMARLDYSKFQTspeyhsggDESLHIQQFYDLLTASMSIIRGWAEKIPGFtELPKCDQELLFE 433
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                  #                     
1OVL_A       114 SAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNXNIDISAFSCIAALAXVTERHGLKE 193
1OVL_B       114 SAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNXNIDISAFSCIAALAXVTERHGLKE 193
gi 118093899 441 SAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKE 520
gi 154147678 434 SAFLELFVLRLAYRSNPAEGKLIFCNGVVLNRLQCVRGFGEWIDSIVDFSSNLHSMNIDISAFSCIAALAVITERHGLKE 513
gi 164698468 441 SAFLELFVLRLAYRSNPMESKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNLDISAFSCIAALAMVTERHGLKE 520
gi 47060285  434 SAFLELFVLRLAYRSNLPEDKLIFCNGMVLHKLQCVRGFGEWIDSIVEFSSNLQSMSLDVSAFSCIAALTIVTERHGLKE 513
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
Feature 1                                                                                      
1OVL_A       194 PKRVEELQNKIVNCLKDHVtfnngglnrpnyLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 271
1OVL_B       194 PKRVEELQNKIVNCLKDHVtfnngglnrpnyLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 271
gi 118093899 521 PKRVEELQNKIVNCLKDHVtfnngglnrpnyLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 598
gi 154147678 514 PKRVEELQNKIVNCLKDHVtfnngglnrpnyLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 591
gi 164698468 521 PKRVEDLQNKIVNCLKDQVtfnggglnrpnyLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 598
gi 47060285  514 PKKAEELQNKLINCLKDQVscs-------geLSKLLEKLPEVRALCTQGLQRIFYLKLEDLVPTPAIIDKLFHDTLPF 584

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap