1UPV,1P8D,3FC6,1UHL


Conserved Protein Domain Family
NR_LBD_LXR

?
cd06954: NR_LBD_LXR 
Click on image for an interactive view with Cn3D
The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors.
The ligand binding domain of Liver X receptors: Liver X receptors (LXRs) belong to a family of nuclear receptors of ligand-activated transcription factors. LXRs operate as cholesterol sensors which protect from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. Upon ligand binding a conformational change leads to recruitment of co-factors, which stimulates expression of target genes. Among the LXR target genes are several genes involved in cholesterol efflux from peripheral tissues such as the ATP-binding-cassette transporters ABCA1, ABCG1 and ApoE. There are two LXR isoforms in mammals, LXRalpha and LXRbeta. LXRalpha is expressed mainly in the liver, intestine, kidney, spleen, and adipose tissue, whereas LXRbeta is ubiquitously expressed at lower level. Both LXRalpha and LXRbeta function as heterodimers with the retinoid X receptor (RX R) which may be activated by either LXR ligands or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. LXR has typical NR modular structure with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and the ligand binding domain (LBD) at the C-terminal.
Statistics
?
PSSM-Id: 132752
View PSSM: cd06954
Aligned: 10 rows
Threshold Bit Score: 379.866
Threshold Setting Gi: 193788681
Created: 5-Dec-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 19 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1UPV_A        20 QELMIQQLVAAQLqcnKRSFSDQPKVTPWPlgadpq-------------------------------------------- 55
gi 193788681 207 QREVIENLVSIHKeleIPGPEDLKRVTPWKegqnsgqdssddngpksvqasdiydtsnplpglmpvsltpkrsedgdgee 286
gi 148234789 204 QEKMIEQLVSAQQqcnKRSFSDQPKVTPWPpgtdpn-------------------------------------------- 239
gi 62955059  175 QQEMIEKLVAMQKqcnKRSFIDRPKVTPWPqsqdpq-------------------------------------------- 210
gi 45383095  172 QLNMIEKLVAAQQqcnQRSFTDRLKVTPWPqvpdpn-------------------------------------------- 207
gi 210114786 128 QTEIVEQLLKAQRevlHPSKEDVEKVTPWPndsdq--------------------------------------------- 162
gi 122049696 324 QRNLVEILQANEArfqWPTQEAVAKVTPWVesgds--------------------------------------------- 358
1P8D_A        13 QELMIQQLVAAQLqcnKRSFSDQPKVTPWPlgadpq-------------------------------------------- 48
3FC6_B        29 QLGMIEKLVAAQQqcnRRSFSDRLRVTPWPiapdpq-------------------------------------------- 64
1UHL_B         5 QLGMIEKLVAAQQqcnRRSFSDRLRVTPWPmapdph-------------------------------------------- 40
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                    #  ## ##                                 #  ##  #          #        
1UPV_A        56 ----srdarQQRFAHFTELAIISVQEIVDFAKQVPGFLqLGREDQIALLKASTIEIMLLETARRYNheteCITFLKDFTY 131
gi 193788681 287 lddqdndalHRRFAHITELTILTIQLIVEYSKHIPGFLtLTREDQILLLKGSAIEVIMLRVALRYDreldAIMFGNEMPY 366
gi 148234789 240 ----srearQQRFAHFTELAIISVQEIVDFAKQVPGFLeLSREDQIALLKASTIEIMLLETARRYNheteCITFLKDFTY 315
gi 62955059  211 ----nrevrQQRFAHFTELAIMSVQEIVDFAKQLPGFLeLTREDQIALLKTSTIEIMLLETSRRYNpaidSITFLKDFTY 286
gi 45383095  208 ----nrearQQRFAHFTELAIISVQEIVDFAKQLPGFReLTREDQIALLKTSTIEVMLLETSRRYNpeieSITFLKDLSY 283
gi 210114786 163 ----skeaaEARFSHFTDLTILGVQAIVEFSKRIPGFLrLTREDQIVLLKSSAIEILVLDVARRYDekmdMLYFWNGLPY 238
gi 122049696 359 -----hrcrASRFAHFTELAILIVQLVVEFTKQLPGFLtVSREDQILLLKACTIEVMLLRAAKQYDkkskAINFLNGKFY 433
1P8D_A        49 ----srdarQQRFAHFTELAIISVQEIVDFAKQVPGFLqLGREDQIALLKASTIEIMLLETARRYNheteCITFLKDFTY 124
3FC6_B        65 ----srearQQRFAHFTELAIVSVQEIVDFAKQLPGFLqLSREDQIALLKTSAIEVMLLETSRRYNpgseSITFLKDFSY 140
1UHL_B        41 ----srearQQRFAHFTELAIVSVQEIVDFAKQLPGFLqLSREDQIALLKTSAIEVMLLETSRRYNpgseSITFLKDFSY 116
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                     #   #                                                              
1UPV_A       132 skddfhraglqvEFINPIFEFSRAMrrLGLDDAEYALLIAINIFSADRPnVQEPGRVEALQQPYVEALLSYTRIKRPqdq 211
gi 193788681 367 trkqll-eggigDLVDPMYNFAKSMseLDLDYAEFILLMAITILSPDRPaINERERVEQMQETYLDMLRSYLKLRRPhev 445
gi 148234789 316 skddfhraglqvEFINPIFEFSRGMrqMQLDDAEYALLIAINIFSADRPnVLNHQHVENLQLPYVEALHSYTRIKRPqdh 395
gi 62955059  287 nkedfakaglqlEFINPIFEFSKGMndLHLDEAEYALLIAINIFSADRPnVQDHELVERLQQPYVDALHSYIRIKRPndh 366
gi 45383095  284 nrddfakaglqfEFINPIFEFSKGMneLQLNDAEYALLIAINIFSADRPnVQDQSLVERLQHTYVEALHSYICINRPndh 363
gi 210114786 239 srhnfk-hagltELVNPMYDFSKRIrnVHIDDTAYAILASIIVLSPDRAdVSDHHTVEKMQEVFLETLQAYIKTTMPsdr 317
gi 122049696 434 dkssfyragmqvEFVDPIFDFCNSMaqLGLNEAEYALLVAINTFSADRPnIKDMHKVEAVQNSYVELLRVYLKIHHPsdp 513
1P8D_A       125 skddfhraglqvEFINPIFEFSRAMrrLGLDDAEYALLIAINIFSADRPnVQEPGRVEALQQPYVEALLSYTRIKRPqdq 204
3FC6_B       141 nredfakaglqvEFINPIFEFSRAMneLQLNDAEFALLIAISIFSADRPnVQDQLQVERLQHTYVEALHAYVSINHPhdp 220
1UHL_B       117 nredfakaglqvEFINPIFEFSRAMneLQLNDAEFALLIAISIFSADRPnVQDQLQVERLQHTYVEALHAYVSIHHPhdr 196
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
Feature 1                           #  ##  #      #   #   #  
1UPV_A       212 LRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 255
gi 193788681 446 LLLPKVLMKLTELRSLNNSHSELLFQLKVKDQKIPPLLQEIWDV 489
gi 148234789 396 LMFPRMLMKLVSLRTLSSVHSEQFFALRLQDKKLPPLLSEIWDV 439
gi 62955059  367 LMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 410
gi 45383095  364 LMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 407
gi 210114786 318 LLLPRILMKLTDLRAINNTHCEQLLALKVENHKIPPLLSEIWDV 361
gi 122049696 514 LMFPRTLMKLVELRTLNNYHSEQIFALKVQDKQLPPLLAEIWDM 557
1P8D_A       205 LRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 248
3FC6_B       221 LMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 264
1UHL_B       197 LMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 240

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap