Conserved Protein Domain Family
reg_near_HchA

?
TIGR03541: reg_near_HchA 
LuxR family transcriptional regulatory, chaperone HchA-associated
Members of this protein family belong to the LuxR transcriptional regulator family, and contain both autoinducer binding (pfam03472) and transcriptional regulator (pfam00196) domains. Members, however, occur only in a few members of the Gammaproteobacteria that have the chaperone/aminopeptidase HchA, and are always encoded by the adjacent gene.
Statistics
?
PSSM-Id: 132580
View PSSM: TIGR03541
Aligned: 5 rows
Threshold Bit Score: 355.246
Threshold Setting Gi: 15596333
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489203389   5 ASLLFDSVARLRKAATTEAVCREMVEFAARLGFDRVIVcsLFPRPDEDELIDELFFVHGDWAEGRSAQERDAYLLHCPVT 84
gi 229336712  14 AVDLITLISQLEESHSFSTVQDIVRQRAHFYGYDKIVF--FSAHSTLDGIIERIYWIEGDWFDDGENIDAATYIKYCPIT 91
gi 499853302   3 FDKVVQAVQQIEQATTLALIQSAVRSVARPLGYDRFVL--FSANAARDEVVERIHWVEGDWFGDGLRVDAQTYIRHCPVN 80
gi 499652940   6 AEALLRAALDIEAAPTLVAIQKAVRGFAGAYGYDRFVL--FSATSASEDVVERIYWVEGDWFGDGIAVDAQTYVQRCPVT 83
gi 491064599   9 AELLFQTLRQIRQASKIEDIFDVVVEFAQNIDFDRLIIcsIAPH-GKEELIDEVFFVYGNWTDRTNIEERNKYLRNCPIT 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489203389  85 RHILELDEPFFWSKSPSEDPERmtYRIVRGVRDLGqV-NGMQVPVFGRNGLEGAVSFAGERLDLNAGCKLAAQAFCPILF 163
gi 229336712  92 RHIIETDRPFFWTKKPDVNREQ--YRVVAKPKGSG-I-HGLQIPIFGHLGLEGAVSLGGKAIDSSPRARCELSLLSTYAF 167
gi 499853302  81 RHLLTAREPFFWSKREGEGGER--YHVVRAPVGTG-V-HGLQVPVFGPAGLEGAMSLGGLHIDASPATRMCLALLANAAF 156
gi 499652940  84 RHLLDARESFFWSKVQEQSGEL--YRLVRVPSGPG-V-HGLQIPVFGPQGLEGAMSLGGEQIDASARVRLALGMLASVAF 159
gi 491064599  88 RHIFDYDEPFFWTKTFNKNNSKetYRVIKNISERG-EeSGVQVPIFGRTGLEGAISFAGKLSDLGADFRFILQSVCVTAF 166
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 489203389 164 FALKRLRGPVSAGDAQALSEREREVLQWIALGKQQAEVAAILMISERTVENHLRAARRRLGAASTAQAVARALRLGDI 241
gi 229336712 168 FAARRLLESSDPNRSALLSKREKEVLSLTALGRRQADIAIALGVSPRTIENHLRNARLKLGGATTAETIRIAIQRGDI 245
gi 499853302 157 HAARRLLEAPVGQEVGVLSERERQVLAWTAAGQRQADIAATLGLSVRTVENHLRAARRRLGVATTAQAIRIALGSGVL 234
gi 499652940 160 FSARRLLEAPLDETAGKLSTREREVLAWVAAGRRQADIAATLGLSGRTVENHLRSARRHLGVATTAQAIKIAIRKGEI 237
gi 491064599 167 REIQSKRSLNLLRENSVLTQREKEILKWTAVGRKQSEIAEILKISERTVENHLRSIRKKLEVKSTGQAIASALLKGEI 244
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap