1HYQ


Conserved Protein Domain Family
minD_arch

?
TIGR01969: minD_arch 
Click on image for an interactive view with Cn3D
cell division ATPase MinD, archaeal
This model represents the archaeal branch of the MinD family. MinD, a weak ATPase, works in bacteria with MinC as a generalized cell division inhibitor and, through interaction with MinE, prevents septum placement inappropriate sites. Often several members of this family are found in archaeal genomes, and the function is uncharacterized. More distantly related proteins ParA chromosome partitioning proteins. The exact roles of the various archaeal MinD homologs are unknown.
Statistics
?
PSSM-Id: 131024
View PSSM: TIGR01969
Aligned: 7 rows
Threshold Bit Score: 357.504
Threshold Setting Gi: 14520779
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HYQ_A         3 RTITVASGKGGTGKTTITANLGVALAQLGHDVTIVDADITMANLELILGMEGLPVTLQNVLAGEARIDEAIYVGPGG-VK 81  Archaeoglobus f...
Q57967         7 IAIAIASGKGGTGKTTISANLAVALAKFGKKVAVLDADIAMANLELIMGLEGKPVTLNDVLAGKADIKDAIYEGPEG-VL 85  Methanocaldococ...
WP_011018590  13 RVVCMASGKGGTGKTTVTANLGTALAELGAETYILDADIAMANLGLILRMEDAPVTLHDVLAGEADIEEAIYEGPHG-VK 91  Methanopyrus ka...
Q57633         4 MIITIASGKGGVGKTTTSASLAVALAKLGKKVLAIDGDISMANLGILFNMEKKKPSLHEVLSEEADVRDAIYKHKTG-VY 82  Methanocaldococ...
WP_010868552   3 RIISIVSGKGGTGKTTVTANLSVALGEMGKKVLAVDGDLTMANLSLVLGVDDVDVTLHDVLAGEAKLQDAIYMTQFDnVY 82  Pyrococcus abyssi
WP_010877442   3 RVITVASGKGGVGKTTITANLGVALSTYGERVVVLDADIAMANLELILGMEGKSVTLHDVLAGNASIEDAVYEGPNG-VR 81  Methanothermoba...
WP_010867687   4 RSIVFASGKGGTGKTTTVANIGVALAQFGKDVILIDADITMANLSLILGMEDIPVTLHDVLAGEADLKDAIYEGPAG-VK 82  Pyrococcus abyssi
1HYQ_A        82 VVPAGVSLEGLRKANPEKLEDVLTQIMESTDILLLDAPAGLERSAVIAIAAAQELLLVVNPEISSITDGLKTKIVAERLG 161 Archaeoglobus f...
Q57967        86 VIPAGVSLEKFRRAKPEKLEEVLKAIHDLVEILIIDCPAGIGKETLIAISSADGLIVVVNPEISSISDALKIIAITKRLG 165 Methanocaldococ...
WP_011018590  92 VIPAGISLEGIRKANPDRLRDVVEHIIDRADFLLIDAPAGLGRDAITALSASTESLLVVNPEIASITDALKVKAVAERVD 171 Methanopyrus ka...
Q57633        83 VLPTSLSLEGYKKSDIDLLPDVVNEVADDFDYVIIDAPAGLNREMATHLAIADKLLLVVTPEMFSIIDAVRLKESAEMAG 162 Methanocaldococ...
WP_010868552  83 VLPGAVDWEHVMKADPRKLPEVIKSLKGDYDFILIDCPAGLQLDAMSAMLSGEEALLVTNPEISCLTDTMKVGIVLRKAG 162 Pyrococcus abyssi
WP_010877442  82 VVPAGISLEGLRNVKLDRLEDALAYLIEDTDILLIDAPAGLEKDAVAALAAADELLLVTTPEVPSISDALKTKIVASKLD 161 Methanothermoba...
WP_010867687  83 VIPGGLSLEKIKKARAERLRDLIREISQMGDFILIDAPAGLELTSITALLIGKELIIVTNPEIAAITDSLKTKLVAEKLG 162 Pyrococcus abyssi
1HYQ_A       162 TKVLGVVVNRITTLGIEMAKNEIEAILEAKVIGLIPEDPEVRRAAAYGKPVVLRSPNSPAARAIVELANYIAGgakkkVP 241 Archaeoglobus f...
Q57967       166 TDIIGAIVNRVSNESTELGVKAIETILEVPVIGVVPEDPHVRKAAAFGTPLVIMYPDSPAAQAIMEIAAKLIG-----AK 240 Methanocaldococ...
WP_011018590 172 TQITGAVVNRVTKDKTELTKEEVEKILETPVMVEVPEDPEVRRAAAFGEPVVVRSPKSAAAQAFKKLAAELVG-----IE 246 Methanopyrus ka...
Q57633       163 TPLMGVVLNRVGRDFGEMGRDEIEMLIKGKVLVEVPEDENVRSAALKKMSVIEYRKNSPASQAYMKLASIIAGvp-iyIE 241 Methanocaldococ...
WP_010868552 163 LAILGFILNRYGRTENDIPPDAAQDVMDVPLLAVIPEDPAIREGTLEGIPAVKYKPESEGAKAFVKLAQEVEK-----L- 236 Pyrococcus abyssi
WP_010877442 162 INIIGVVINREQYDKTFLSVEEVETILEVPVIAVIPDDPEVSRAAAFGEPIVIKNPKSPASNALMELAADLIG-----EE 236 Methanothermoba...
WP_010867687 163 TLPLGAILNRVTSEKTELSREEIEALLEVPVLGTVPEDPEVKRASAYGVPLVVKNPTSPAAIAYKEIAAKLAG-----IK 237 Pyrococcus abyssi
1HYQ_A       242 AEVKEKKK-EGALAKMLR 258 Archaeoglobus fulgidus
Q57967       241 YEAQLKKKkESFISKFIK 258 Methanocaldococcus jannaschii DSM 2661
WP_011018590 247 YEVPVPDK-EGVLSKVIK 263 Methanopyrus kandleri
Q57633       242 DEIKIIRK-ESFIDKIKR 258 Methanocaldococcus jannaschii DSM 2661
WP_010868552 237 ---------AGIKAKVMY 245 Pyrococcus abyssi
WP_010877442 237 YQPIEPDK-QGVIAKLIS 253 Methanothermobacter thermautotrophicus
WP_010867687 238 WKPPEP---ESPVKRIFR 252 Pyrococcus abyssi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap