1X9E


Conserved Protein Domain Family
HMG-CoA-S_prok

?
TIGR01835: HMG-CoA-S_prok (this model, PSSM-Id:130894 is obsolete and has been replaced by 213655)
Click on image for an interactive view with Cn3D
3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade
This clade of hydroxymethylglutaryl-CoA (HMG-CoA) synthases is found in a limited spectrum of mostly gram-positive bacteria which make isopentenyl pyrophosphate (IPP) via the mevalonate pathway. This pathway is found primarily in eukaryotes and archaea, but the bacterial homologs are distinct, having aparrently diverged after being laterally transferred from an early eukaryote. HMG-CoA synthase is the first step in the pathway and joins acetyl-CoA with acetoacetyl-CoA with the release of one molecule of CoA. The Borellia sequence may have resulted from a separate lateral transfer event.
Statistics
?
PSSM-Id: 130894
View PSSM: TIGR01835
Aligned: 7 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 16-Nov-2011
Updated: 8-Dec-2011
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1X9E_A        3 IGIDKISFFVPPYYIDMTALAE-----ARNVDPGKFHIGIG---QDQMAVNPISQDIVTFAANAAEAILTKE--DKEAID 72  Enterococcus fae...
CAD24420      9 TGIEAISFYTPQNYVGLDILAA-----HHGIDPEKFSKGIG---QEKIALPGHDEDIVTMAAEAALPIIERA--GTQGID 78  Paracoccus zeaxa...
ZP_03948676  59 IGIDKISFFVPPYYIDMTALAE-----ARNVDPGKFHIGIG---QDQMAVNPISQDIVTFAANAAEAILTKE--DKEAID 128 Enterococcus fae...
NP_693169     3 IGIDKIGFYAPHLYLDMNELAE-----ERGVEPEKFTIGIG---QEKMAVPPITQDTVTLAANAAAQILDET--DKQDID 72  Oceanobacillus i...
NP_346164    11 IGIDKIGFATSQYVLKLQDLAE-----ARGIDPEKLSKGLL---LKELSIAPLTEDIVTLAASASDSILTEQ--ERQEVD 80  Streptococcus pn...
NP_212817     3 IGISDIRIFLPLNYLDFSVLLEnplyfSNEVFFKKINRAIDatlQKGFRFTSPNEDSVTMASSAVKLIFDNNnlDLSKIR 82  Borrelia burgdor...
BAB07795      5 IGIHDLSFATTEFVLPHTALAE-----YNGTEIGKYHVGIG---QQSMSVPAADEDIVTMAATAARPIIERN--GKSRIR 74  Streptomyces sp....
1X9E_A       73 MVIVGTESSIDESKAAAVVLHRLMGIQPFAR-----SFEIKEACYGATAGLQLAKNHVALHPD-KKVLVVAADIAKYGLN 146 Enterococcus fae...
CAD24420     79 TVLFATESGIDQSKAAAIYLRRLLDLSPNCR-----CVELKQACYSATAALQMACAHVARKPD-RKVLVIASDVARYDRE 152 Paracoccus zeaxa...
ZP_03948676 129 MVIVGTESSIDESKAAAVVLHRLMGIQPFAR-----SFEIKEACYGATAGLQLAKNHVALHPD-KKVLVVAADIAKYGLN 202 Enterococcus fae...
NP_693169    73 MVIFGTESGIDHSKSAAVNVHQLLGLQPHAR-----AIELKQACYGATAGIQMARGHIALNPN-RKVLVLGSDIARYGLR 146 Oceanobacillus i...
NP_346164    81 MVIVATESGIDQSKAAAVFVHGLLGIQPFAR-----SFEIKEACYGATAALHYAKLHVENSPE-SKVLVIASDIAKYGIE 154 Streptococcus pn...
NP_212817    83 ILLGGTETGVDHSKAISSYVFGALKQSGICLgnnflTFQVQHACAGAAMSLHTVASVLSHSNNsEYGIVFSSDIAHYSNL 162 Borrelia burgdor...
BAB07795     75 TVVFATESSIDQAKAGGVYVHSLLGLESACR-----VVELKQACYGATAALQFAIGLVRRDPA-QQVLVIASDVSKYELD 148 Streptomyces sp....
1X9E_A      147 SGGEPTQGAGAVAMLVASEPRILALKEDNV-MLTQDIYDFWRPTGHPYPMVDGPLSNETYIQSFAQVWDEHKKRTGLDFA 225 Enterococcus fae...
CAD24420    153 SSGEATQGAGAVAILVSADPKVAEIGTVSG-LFTEDIMDFWRPNHRRTPLFDGKASTLRYLNALVEAWNDYRANGGHEFA 231 Paracoccus zeaxa...
ZP_03948676 203 SGGEPTQGAGAVAMLVASEPRILALKEDNV-MLTQDIYDFWRPTGHPYPMVDGPLSNETYIQSFAQVWDEHKKRTGLDFA 281 Enterococcus fae...
NP_693169   147 TPGESTQGAGAVALLISADPSIMAIEQEST-YYTDDIMDFWRPVYSDIAFVDGKYSNEQYIAFFQKVWNAYKEQTNRGLE 225 Oceanobacillus i...
NP_346164   155 TPGEPTQGAGSVAMLITQNPRMMAFNNDNV-AQTRDIMDFWRPNYSTTPYVNGVYSTQQYLDSLKTTWLEYQKRYQLTLD 233 Streptococcus pn...
NP_212817   163 TTAEITQGAGATAILIEKNPKLLSINLSEFgVYTDDVDDFFRPFGSVEAKVRGQYSVECYNNANENALRDFAFKKQLSMK 242 Borrelia burgdor...
BAB07795    149 SPGEATQGAAAVAMLVGADPALLRIEEPSG-LFTADVMDFWRPNYLTTALVDGQESINAYLQAVEGAWKDYAEQDGRSLE 227 Streptomyces sp....
1X9E_A      226 DYDA---LAFHIPYTKMGKKALLAKISDQTEAE-Q-ERILARYeesiIYSR------RVGNLYTGSLYLGLISLLENAt- 293 Enterococcus fae...
CAD24420    232 DFAH---FCYHVPFSRMGEKANSHLAKANKTPV-DmGQVQTGL----IYNR------QVGNCYTGSIYLAFASLLENAq- 296 Paracoccus zeaxa...
ZP_03948676 282 DYDA---LAFHIPYTKMGKKALLAKISDQTEAE-Q-ERILARYeesiVYSR------RVGNLYTGSLYLGLISLLENAt- 349 Enterococcus fae...
NP_693169   226 DFAA---ICFHLPYTKMGLKALRTVLDEVEENT-Q-THLKEQYrlstQYNR------NIGNIYTGSLYLSLLSLLENSn- 293 Oceanobacillus i...
NP_346164   234 DFAA---VCFHLPYPKLALKGLKKIMDKSLPQEkK-DLLQKHFdqsiLYSQ------KVGNIYTGSLFLGLLSLLENTd- 302 Streptococcus pn...
NP_212817   243 DLFSnyrFVLHVPFAKMPIDSMHYILKKYYSD--D-ESVRNAYlesiDFYDgveaamEVGNLYTGSIFLSLAFYLKRVfs 319 Borrelia burgdor...
BAB07795    228 EFAA---FVYHQPFTKMAYKAHRHLLNFNGYDT-DkDAIEGALgqttAYNN------VIGNSYTASVYLGLAALLDQA-- 295 Streptomyces sp....
1X9E_A      294 -TLTAGNQIGLFSYGSGAVAEFFTGELVAGYQNHLQKETHLALLDNRTELSIAEYEAMFAETLDTDId----QTLEDELK 368 Enterococcus fae...
CAD24420    297 -EDLTGALVGLFSYGSGATGEFFDARIAPGYRDHLFAERHRELLQDRTPVTYDEYVALWDEIDLTQG-----APDKARGR 370 Paracoccus zeaxa...
ZP_03948676 350 -TLTAGNQIGLFSYGSGAVAEFFTGELVAGYQNHLQKETHLALLDNRTELSIAEYEAMFAETLDTDId----QTLEDELK 424 Enterococcus fae...
NP_693169   294 -ELTAGDKIGMYSYGSGAVGEFFSGVLQEGFEKQLHQTKHNAMFEKRQKISVSEYEKIFEQQIPTDGsvtewSTKEDPAE 372 Oceanobacillus i...
NP_346164   303 -SLKAGDKIALYSYGSGAVAEFFSGELVEGYEAYLDKDR-LNKLNQRTALSVADYEKVFFEEVNLDEtnsaqFAGYENQD 380 Streptococcus pn...
NP_212817   320 kKDITGEKILFCSYGSGNIMIIYELTIEKSAFDVIKLWDLEGLIKNRNNANFEEYKDFFQNKII---------PGESRGF 390 Borrelia burgdor...
BAB07795    296 -DDLTGRSIGFLSYGSGSVAEFFSGTVVAGYRERLRTEANQEAIARRKSVDYATYRELHEYTLPSDGgd-haTPVQTTGP 373 Streptomyces sp....
1X9E_A      369 YSISAINNTVRSY 381 Enterococcus faecalis PC1.1
CAD24420    371 FRLAGIEDEKRIY 383 Paracoccus zeaxanthinifaciens
ZP_03948676 425 YSISAINNTVRSY 437 Enterococcus faecalis TX0104
NP_693169   373 ICLTGIQNHQRIY 385 Oceanobacillus iheyensis HTE831
NP_346164   381 FALVEILDHQRRY 393 Streptococcus pneumoniae TIGR4
NP_212817   391 YLKELRNDGYRVY 403 Borrelia burgdorferi B31
BAB07795    374 FRLAGINDHKRIY 386 Streptomyces sp. CL190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap