Conserved Protein Domain Family
hCaCC

?
TIGR00868: hCaCC 
calcium-activated chloride channel protein 1
found a row in 1A13.INFO that was not parsed out AC found a row in 1A13.INFO that was not parsed out EC found a row in 1A13.INFO that was not parsed out GA found a row in 1A13.INFO that was not parsed out SO found a row in 1A13.INFO that was not parsed out RH found a row in 1A13.INFO that was not parsed out EN found a row in 1A13.INFO that was not parsed out GS found a row in 1A13.INFO that was not parsed out AL found a row in 1A13.INFO that was not parsed out The Epithelial Chloride Channel (E-ClC) Family (TC 1.A.13) found a row in 1A13.INFO that was not parsed out found a row in 1A13.INFO that was not parsed out Mammals have multiple isoforms of epithelial chloride channel proteins. The first member of this family to be characterized was a respiratory epithelium, Ca found a row in 1A13.INFO that was not parsed out 2+-regulated, chloride channel protein isolated from bovine tracheal apical membranes. It was biochemically characterized as a 140 kDa complex. The purified found a row in 1A13.INFO that was not parsed out complex when reconstituted in a planar lipid bilayer behaved as an anion-selective channel. It was regulated by Ca 2+ via a calmodulin kinase II-dependent found a row in 1A13.INFO that was not parsed out mechanism. When the cRNA was injected into Xenopus oocytes, an outward rectifying, DIDS-sensitive, anion conductance was measured. A related gene, found a row in 1A13.INFO that was not parsed out Lu-ECAM, was cloned from the bovine aortic endothelial cell line, BAEC. It is expressed in the lung and spleen but not in the trachea. Homologues are found in found a row in 1A13.INFO that was not parsed out several mammals, and at least three paralogues(hCaCC-1-3) are present in humans, each with different tissue distributions. found a row in 1A13.INFO that was not parsed out [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 129946
View PSSM: TIGR00868
Aligned: 4 rows
Threshold Bit Score: 1665.79
Threshold Setting Gi: 5726289
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
TIGR00868 is a member of the superfamily cl26751.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1706571   1 MVPRLTVILFLTLHLLPGMK-SSMVNLINNGYDGIVIAINPSVPEDEKLIQNIKEMVTEASTYLFHATKRRVYFRNVSIL 79
gi 6002646   1 MGSFRSSLFILVLHLLEGAQsNSLIQLNGNGYEGIVIAIDPNVPEDERLIQNIKDMVTKASPYLFEATEKRFYFKNVAIL 80
gi 5726289   1 MGLFRGFVFLLVLCLLHQSN-TSFIKLNNNGFEDIVIVIDPSVPEDEKIIEQIEDMVTTASTYLFEATEKRFFFKNVSIL 79
gi 3560547   1 MVPGLQVLLFLTLHLLQNTE-SSMVHLNSNGYEGVVIAINPSVPEDERLIPSIKEMVTQASTYLFEASQGRVYFRNISIL 79
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1706571  80 IPMTWKSKSEYLMPKQESYDQAEVIVANPYLKHGDDPYTLQYGRCGEKGQYIHFTPNFLLTNNLPIYGSRGRAFVHEWAH 159
gi 6002646  81 IPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAH 160
gi 5726289  80 IPENWKENPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQFTECGEKGEYIHFTPDLLLGKKQNEYGPPGKLFVHEWAH 159
gi 3560547  80 VPMTWKSKPEYLMPKRESYDKADVIVADPHLQHGDDPYTLQYGQCGDRGQYIHFTPNFLLTDNLRIYGPRGRVFVHEWAH 159
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1706571 160 LRWGIFDEYNGDQPFYISrRNTIEATRCSTHITGTNVIVKCQGGSCITRPCRRDSQTGLYEAKCTFIPEKSQTARESIMF 239
gi 6002646 161 LRWGVFNEYNNEQKFYLS-NKKEQPVICSAAIRGTNVLPQCQGGSCVTKPCRADRVTGLFQKECEFIPDPQQSEKASIMF 239
gi 5726289 160 LRWGVFDEYNEDQPFYRAkSKKIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQTEKASIMF 239
gi 3560547 160 LRWGVFDEYNVDQPFYMSrKNTIEATRCSTRITGTNVVHNCERGNCVTRACRRDSKTRLYEPKCTFIPDKIQTAGASIMF 239
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1706571 240 MQSLHSVTEFCTEKTHNVEAPNLQNKMCNGKSTWDVIMNSTDFQNTSPMTEMnpPTQPTFSLLKSKQRVVCLVLDKSGSM 319
gi 6002646 240 AQSIDTVVEFCKEKNHNKEAPNDQNQKCNLRSTWEVIQDSEDFKKTTPMTTQ--PPAPTFSLLQIGQRIVCLVLDKSGSM 317
gi 5726289 240 MQSIDSVVEFCNEKTHNQEAPSLQNIKCNFRSTWEVISNSEDFKNTIPMVTP--PPPPVFSLLKIRQRIVCLVLDKSGSM 317
gi 3560547 240 MQNLNSVVEFCTEKNHNAEAPNLQNKMCNRRSTWDVIKTSADFQNAPPMRGTeaPPPPTFSLLKSRRRVVCLVLDKSGSM 319
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1706571 320 SSEDRLFRMNQAAELFLIQIIEKGSLVGMVTFDSVAEIRNNLTKITDDNVYENITANLPQEANGGTSICRGLKAGFQAII 399
gi 6002646 318 TVGGRLKRLNQAGKLFLLQTVEQGAWVGMVAFDSAAYVKSELVQINSAAERDALARSLPTAASGGTSICSGLRSAFTVIK 397
gi 5726289 318 GGKDRLNRMNQAAKHFLLQTVENGSWVGMVHFDSTATIVNKLIQIKSSDERNTLMAGLPTYPLGGTSICSGIKYAFQVIG 397
gi 3560547 320 DKEDRLIRMNQAAELYLTQIVEKESMVGLVTFDSAAHIQNYLIKITSSSDYQKITANLPQQASGGTSICHGLQAGFQAIT 399
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1706571 400 QSQQsTSGSEIILLTDGEDNEIHSCIEEVKQSGVIIHTIALGPSAAKELETLSDMTGGHRFYAN--KDINGLTNAFSRIS 477
gi 6002646 398 KKYP-TDGSEIVLLTDGEDNTISACFPEVKQNGAIIHTVALGPSAAKELEELSQMTGGLQTYASdqAENNGLIDAFGALS 476
gi 5726289 398 ELHSqLDGSEVLLLTDGEDNTASSCIDEVKQSGAIVHFIALGRAADEAVIEMSKITGGSHFYVSdeAQNNGLIDAFGALT 477
gi 3560547 400 SSDQsTSGSEIVLLTDGEDNGIRSCFEAVSRSGAIIHTIALGPSAARELETLSDMTGGLRFYAN--KDLNSLIDAFSRIS 477
                      490       500       510       520       530       540       550       560
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1706571 478 SRSGSITQQTIQLESKALAITEKKWVNGTVPVDSTIGNDTFFVVTWT--IKKPEILLQDPKGKkyKTSDFKEDKLNiHSA 555
gi 6002646 477 SGNRAASQRSIQLESQGLTLQNNEWMNGTVVVDSTVGKDTLFLITLErkFLSPIPFFGVPSGR--SQDSFLVGKHN-KMA 553
gi 5726289 478 SGNTDLSQKSLQLESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWN--SLPPSISLWDPSGT--IMENFTVDATS-KMA 552
gi 3560547 478 STSGSVSQQALQLESKAFDVRAGAWINGTVPLDSTVGNDTFFVITWM--VKKPEIILQDPKGKkyTTSDFQDDKLNiRSA 555
                      570       580       590       600       610       620       630       640
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1706571 556 RLRIPGIAETGTWTYSLLNNhAspQILTVTVTTRARSPTTPPVTATAHMSQNTAHYPSPVIVYAQVSQGFLPVLGINVTA 635
gi 6002646 554 YFQVPGTAKVGMWKYSLQAS-S--QTLTLTVSSRRSSATLPPVTVTSKMNKDTGKFPSPMVVYTKIHQGTLPILRAKVTA 630
gi 5726289 553 YLSIPGTAKVGTWAYNLQAK-AnpETLTITVTSRAANSSVPPITVNAKMNKDVNSFPSPMIVYAEILQGYVPVLGANVTA 631
gi 3560547 556 RLQIPGTAETGTWTYSITG--TksQLITMTVTTRARSPTMEPLLATAHMSQSTAQYPSRMIVYARVSQGFLPVLGANVTA 633
                      650       660       670       680       690       700       710       720
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1706571 636 IIETEDGHQVTLELWDNGAGADTVKNDGIYSRYFTDYRGNGRYSLKVHAEARNNTARLSLRQPQNKALYIPGYIENGKII 715
gi 6002646 631 LIESENGKTVTLELLDNGAGADATKNDGIYSRYFTAYDANGRYSVKVWALGGVNTPRRRAPPLWSGAMYIRGWIENGEIK 710
gi 5726289 632 FIESQNGHTEVLELLDNGAGADSFKNDGVYSRYFTAYTENGRYSLKVRAHGGANTARLKLRPPLNRAAYIPGWVVNGEIE 711
gi 3560547 634 LIEAEHGHQVTLELWDNGAGADTVKNDGIYTRYFTDYHGNSRYSLKVRVQAQRNKTRLSLRQ-KNKSLYIPGYVENGKIV 712
                      730       740       750       760       770       780       790       800
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1706571 716 LNPPRPEVKDDLAKAEIEDFSRLTSGGSFTVSGAPP-GNHPSVLPPNKIIDLEAKFKEDHIQ-LSWTAPANVLDKGKANS 793
gi 6002646 711 WNPPRPDINKDDLQGKQVCFSRTASGGSFVASDVPK-SPIPDLFPPCKITDLKAGIQGDNLInLTWTAPGDDYDHGRADR 789
gi 5726289 712 ANPPRPEID-EDTQTTLEDFSRTASGGAFVVSQVPS-LPLPDQYPPSQITDLDATVHEDKII-LTWTAPGDNFDVGKVQR 788
gi 3560547 713 LNPPRPDVQEEAIEATVEDFNRVTSGGSFTVSGAPPdGDHARVFPPSKVTDLEAEFIGDYIH-LTWTAPGKVLDNGRAHR 791
                      810       820       830       840       850       860       870
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1706571 794 YIIRISKSFLDLQKDFDNATLVNTSSLKPKEAGSDENFEFKPEPFRIENGTNFYIAVQAINEANLTSEVSNIAQ 867
gi 6002646 790 YIIRISTNILDLRDKFNDSVQVNTTDLIPKEANSEEVFVFKPEGIPFTNGTDLFIAVQAVDKTNLKSEISNIAQ 863
gi 5726289 789 YIIRISASILDLRDSFDDALQVNTTDLSPKEANSKESFAFKPENISEENATHIFIAIKSIDKSNLTSKVSNIAQ 862
gi 3560547 792 YIIRMSQHPLDLQEDFNNATLVNASSLIPKEAGSKETFKFKPETFKIANGIQLYIAIQADNEASLTSEVSNIAQ 865
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap