Conserved Protein Domain Family
HMG_CoA_syn_Arc

?
TIGR00748: HMG_CoA_syn_Arc (this model, PSSM-Id:129831 is obsolete and has been replaced by 273250)
hydroxymethylglutaryl-CoA synthase, putative
This family of archaeal proteins shows considerable homology and identical active site residues to the bacterial hydroxymethylglutaryl-CoA synthase (HMG-CoA synthase, modeled by TIGR01835) which is the second step in the mevalonate pathway of IPP biosynthesis. An enzyme from Pseudomonas fluorescens involved in the biosynthesis of the polyketide diacetyl-phloroglucinol is more closely related, but lacks the active site residues. In each of the genomes containing a member of this family there is no other recognized HMG-CoA synthase, although other elements of the mevalonate pathway are in evidence. The only archaeon currently sequenced which lacks a homolog in this pathway is Halobacterium, which _does_ contain a separate HMG-CoA synthase. Thus, although there is no experimental evidence supporting this name, the bioinformatics-based conclusion appears to be sound [Fatty acid and phospholipid metabolism, Biosynthesis].
Statistics
?
PSSM-Id: 129831
View PSSM: TIGR00748
Aligned: 3 rows
Threshold Bit Score: 638.889
Threshold Setting Gi: 24638372
Created: 11-Sep-2012
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58941   1 MAGIVGYGAYIPKYRIKVEEIARVWNkdpesIKKgLLVYEKAVPSLDEDTATIAVEAARNALKRAEIDPKDIGAVYVGSE 80  Methanocaldococcus ja...
O58410  10 DVGIVGYGAYVPMYRIRNEEIGRVWG-----ISN-FPIEEKAVPGLDEDAITIGIEAARNALKRAKIDPKDIRAIWFGSE 83  Pyrococcus horikoshii...
O26883   1 MAGIVGYGVYIPSYRIKVEEIARVWGddpqaISRgLVVEEKSVPGPDEDTATISVEAARNALRRSQIDPSEIGAVYVGSE 80  Methanothermobacter t...
Q58941  81 SHPYAVKPTATIVAEAIDATPDLTAADLEFACKAGTAGIQMCMGLVESGLIKYGLAIGADTAQGAPGDALEYTAAAGGAA 160 Methanocaldococcus ja...
O58410  84 SKPYAVKPSSTVIAEAIGATPDLEAADFEFACKAGTEALQAAIGFVASGMAKYAMAIGADTAQGRPGDHLEFTAGAGGAA 163 Pyrococcus horikoshii...
O26883  81 SHPYAVKPTATIVAEAVEATPEMTAADLEFACKAGTAGIQACMGLVDSGIIKYGLAVGADTAQGAPGDALEYTASAGGAA 160 Methanothermobacter t...
Q58941 161 YIIGKSN--VIAEFNGTYSYTTDTPDFWRREGKPYPRHGGRFTGEPAYFRHVINAAKGLMEKMGTKPEDYDYCVFHQPNG 238 Methanocaldococcus ja...
O58410 164 FIIGEKSseTVAYFEGSYSYVTDTPDFWRRQHEHYPRHGNRFTGEPAYFHHVVTAAKTLMDELGLTPEDFDYAVFHQPNV 243 Pyrococcus horikoshii...
O26883 161 YVIGGKN--CLADIKETYSFTTDTPDFYRREGMPYPRHGGRFTGEPAYFKHVLGAARGMMEKTGLSADDFDYAVFHQPNG 238 Methanothermobacter t...
Q58941 239 KFYIRVAKILGFKEEQYKIGLLTPYIGNTYSGAVPLGLSNVLDNCEGGERILAVSYGSGAGSDAFDITVTDRINKVKDKA 318 Methanocaldococcus ja...
O58410 244 KFPLVAARMLGIPKEKVLPGLLSGRIGNTYSGATMVGISAVLDIAKPGDRILWVSFGSGAGSDAFSIVVQDAIEEKRNLA 323 Pyrococcus horikoshii...
O26883 239 KFYLKAARKLGFESEQVKPGLLTPVIGNTYSGATPVGLAATLDVAEPGARILAVSYGSGAGSDAFIIEVNDLIEERRDLA 318 Methanothermobacter t...
Q58941 319 PKTAYYLERKEYIDYAIYAKFRKKIKM 345 Methanocaldococcus jannaschii DSM 2661
O58410 324 PKVEDYIKRRKVIDYALYAKARRKYII 350 Pyrococcus horikoshii OT3
O26883 319 PSVAEIIKNKRYVDYALYAKFKGKLRM 345 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap