1NMN,1VHX


Conserved Protein Domain Family
RNAse_H_YqgF

?
TIGR00250: RNAse_H_YqgF 
Click on image for an interactive view with Cn3D
putative transcription antitermination factor YqgF
This protein family, which exhibits an RNAse H fold in crystal structure, has been proposed as a putative Holliday junction resolvase, an alternate to RuvC. [Unknown function, General]
Statistics
?
PSSM-Id: 129352
View PSSM: TIGR00250
Aligned: 6 rows
Threshold Bit Score: 198.126
Threshold Setting Gi: 40889964
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NMN_A       6 LAFDFGTKSIGVAvGQRITG-TARPLPAIKAQDGTPDW--NIIERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANR 82
gi 1731018   6 LAFDFGTKSIGVAvGQRITG-TARPLPAIKAQDGTPDW--NIIERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANR 82
gi 1175215   6 LAFDFGTKSIGCAiGQSITG-TAQALPAFKAQDGIPNW--EAIEKCLKEWKPDVVIVGLPLNMDGTEQDLTLRARKFANR 82
gi 6226451   8 LGLDVGRKRIGVA-GCDGTGlIATGITTIVRSSYDQDI--AQIKQLVEERNVNLLVVGLPYTMAGEIGSQAKQVQKFARR 84
gi 6226496   4 LGLDLGTKTLGVA-LSDEMGwTAQGIETIKINEAEGDYglSRLSELIKDYTIDKIVLGFPKNMNGTVGPRGEASQTFAKV 82
1VHX_A       6 LGLDLGTKTLGVA-LSDEXGwTAQGIETIKINEAEGDYglSRLSELIKDYTIDKIVLGFPKNXNGTVGPRGEASQTFAKV 84
                       90       100       110       120       130
               ....*....|....*....|....*....|....*....|....*....|...
1NMN_A      83 IHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGKVDSASAVIILESYFE 135
gi 1731018  83 IHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGKVDSASAVIILESYFE 135
gi 1175215  83 LQGRFGVNVHLQDERLTTTQARSEIFERGGFKALKKGKIDGVSACLILESWFE 135
gi 6226451  85 VAEQLHLPLEYMDERLSSVEAENQLKARKRFSSYDKGLIDQQAAEIILQQWLD 137
gi 6226496  83 LETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVIDKMAAVMILQGYLD 135
1VHX_A      85 LETTYNVPVVLWDERLTTXAAEKXLIAADVSRQKRKKVIDKXAAVXILQGYLD 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap