Conserved Protein Domain Family
lpxB

?
TIGR00215: lpxB 
lipid-A-disaccharide synthase
Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129319
View PSSM: TIGR00215
Aligned: 4 rows
Threshold Bit Score: 537.17
Threshold Setting Gi: 3913997
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507058     1 MNKTNP-TIalVAGEVSGDILGAGLIRQLKAHYPNARFIGIAGPRMLAEGCETLVDMEELSVMGLAEILKHLPRLLKIRK 79
gi 14285539    1 MRIFIStGE--VSGDLQGSLLVGALRQQAEEQNLELELVGLGGEKMAAAGLTLLANTAAIGSVGLTESLRFIIPTWQIQQ 78
gi 3913997     1 M----P-TIlvSALEASSNAHLEELRQNLPEDY---RFIGVF------EGKEVLYSPREFSIMGFRDVIGRLGFLLKAHK 66
gi 446061799   1 MTEQRPlTIalVAGETSGDILGAGLIRALKEHVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507058    80 NVIQTMLQEKPDVYIGIDAPDFNLDV--ELKLKANGIKTIHYVSPSVWAWR--QNRIHKIAKATHQVLAFLPFEKAFYDK 155
gi 14285539   79 RVKRYLKTNPIDLLVLIDYMGPNLTIanYLRKTYPNLPILYYIAPQAWVWSptKRETAQIMAVTDRLLAIFPGEAEFFQK 158
gi 3913997    67 EMVQLAKQADMVLLMDSSSFNIPLAK--KIKKQDPHKKIMYYILPQVWAWK--KWRAKSLEKYCDFLGAILPFEVGYYQK 142
gi 446061799  81 DLTKRFGELKPDVFVGIDAPDFNITL--EGNLKKQGIKTIHYVSPSVWAWR--QKRVFKIGRATDLVLAFLPFEKAFYDK 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507058   156 FNVPCRFIGHTMADAIPLK-PNRAEACQTLQIDPAQRYLAILVGSRGSEVEFLAEPFLKTALLLKEQFPDLQFLVPLVNE 234
gi 14285539  159 QGLDVTWVGHPLLDRITKEaPSRGSAREKLGIDHNETVITLLPASRIQELRYLLPSICGAAQQLQSQLPNVKLLLPVSLK 238
gi 3913997   143 KAQ---YVGHPLLDEIKHYkKDIK-----------GETLVFMPGSRKSEIAKMFPLFVKAAQMLEQNEGFKRRVLVVPSF 208
gi 446061799 157 YNVPCRFIGHTMADAMPLD-PDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQTYPDLEIVVPLVNA 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507058   235 KRRIQFETIKAKItpNLDLHLIDGNARQ-AMIAADATLLASGTAALEAMLCKSPMVVGYRMKPLTYFLAKRLVKTD--YI 311
gi 14285539  239 DYQPQIEQTLKEF--NLTVQLLEGKETLtAIAAADLAITKSGTVNLEIALLNVPQVILYRVSPLTMAIARRIFKFNlpFV 316
gi 3913997   209 FKGLD---LKALYgeDIQLFEISYDAHK-SLFEAEFAFICSGTATLEAALIGTPFVLAYRAKTMDFLIARMLVNLH--YI 282
gi 446061799 236 KRREQFERIKAEVapDLSVHLLDGMGRE-AMVASDAALLASGTAALECMLAKCPMVVGYRMKPFTFWLAKRLVKTD--YV 312
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 2507058   312 SLPNLLANEMLVPEMIQEECTPELLAEKLSVYLSDDesavKNRHVLIQHFTDLHQKIQCNAD-KQAAQAVIDL 383
gi 14285539  317 SPTNIVLNRGIMPELLQEQATASNIAQAGLELLLNG----DRQAKIAQDYQELREALGEPGVcERAAQAVLEF 385
gi 3913997   283 GLANIFYNALNNETPGLGESQLHPELIQHFLSVEGLlkayKEMDRERYFKESLRLREYLKHGsARKIANEMAF 355
gi 446061799 313 SLPNLLAGRELVKELLQEECEPQKLAAALLPLLANG----KTSHAMHDTFRELHQQIRCNAD-EQAAQAVLEL 380
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap