1AH9


Conserved Protein Domain Family
infA

?
TIGR00008: infA (this model, PSSM-Id:129120 is obsolete and has been replaced by 188015)
Click on image for an interactive view with Cn3D
translation initiation factor IF-1
This family consists of translation initiation factor IF-1 as found in bacteria and chloroplasts. This protein, about 70 residues in length, consists largely of an S1 RNA binding domain (pfam00575).
Statistics
?
PSSM-Id: 129120
View PSSM: TIGR00008
Aligned: 13 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 2-Feb-2010
Updated: 19-Feb-2010
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1AH9_A        2 KEDNIEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFR 69 
P12134        3 KQKLIDMEGVVIESLPNATFRVYLDNGCIVLTHISGKIRRNYIRILPGDRVKVELSPYDLTKGRITYR 70  liverwort
CAA83713      3 KETEMEFEGTVVEVLPNAQFKVKLENGVVINAHVSGKIRMHYIRILPGDKVTIVISPYDMTRGRITYR 70  Mycoplasma capricolum subsp....
P41632        3 KQNLIHAEGLVTESLPNGMFRVLTDNGCQILTHISGRIRRNSVRILPGDRVKVELSAYDLTKGRIIYR 70  Japanese black pine
P12135       14 REAKITFEGLVMEALPNGMFRVRLENDTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYR 81  Oryza sativa
P08698        2 KEQKWIHEGLITESLPNGMFWVRLDNEDPILGYVSGRIRRSSIRILPGDRVKIEVSRYDSTRGRIIYR 69  spinach
P30070        2 KEQKWIHEGLITESLTNGMFWVRLDNKDLIIGYVSGNIRHSFIRILPGDKVKIEVSRYNSTRGRIIYR 69  beechdrops
P38037       21 KEEVIKMTGKVTKMHSTKNYDVLLENDQEIKAYISGKMSLHNIKLIPGDMVDVEISPFNLTLGRIVFR 88  Mycoplasma sp.
P47419        2 KNDKLFLTGKILEIIHGDKYRVMLENNVEVDAHLAGKMKMKRTKILPGDVVEVEFSPYDLKLGRITQR 69  Mycoplasma genitalium
NP_388020     3 KDDVIEVEGTIVETLPNAMFKVELENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYR 70  Bacillus subtilis subsp. sub...
S17988        3 KDDVIEVDGKVVDTMPNAMFTVELENGHQVLATISGKIRKNYIRILPGDKVQVELSPYDLTRGRITYR 70  Lactococcus lactis subsp. la...
P45957        4 KDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYR 71  Mycobacterium tuberculosis
ZP_02478299   3 KEDCIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIIFR 70  Haemophilus parasuis 29755
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap