2QO3,2HG4,2VZ8


Conserved Protein Domain Family
PKS_KS

?
smart00825: PKS_KS (this model, PSSM-Id:129058 is obsolete and has been replaced by 214836)
Click on image for an interactive view with Cn3D
Beta-ketoacyl synthase
The structure of beta-ketoacyl synthase is similar to that of the thiolase family and also chalcone synthase. The active site of beta-ketoacyl synthase is located between the N and C-terminal domains.
Statistics
?
PSSM-Id: 129058
View PSSM: smart00825
Aligned: 2251 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 14-Apr-2009
Updated: 29-Apr-2009
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QO3_A          8 IAIVSMACRLP-GgVNTPQRLWELLREGGETLSGFPTDRGWDLARLhHPDpDNPGtSYVDKGGFLDDAAGFDAEFFGVSP 86
gi 154244957   52 IAIVAAGCRFP-GgADDLDAYWRLLREGRDAVRPVPADRWDVD----DPDaARA---YARDMASLDDIAGFDAGFFGISP 123
gi 37223144    12 VAIIGSACRFP-GgASSPEAFWNLLRRGTDFVGPVPAGRWDGEAIh-DAGaSRPGtTYCREGAFLDEVDRFDARFFGITA 89
gi 37223144  1033 VAVLGMACRLP-R-ADSPEALWEVLLEQATCVVPVPSSRLt----------EPVGtR--RHASLVERVEGFDEDFFRISP 1098
gi 70730155    12 IAIIGSGCRFAkG-ASTPEAFWELLRAGTDFVGPVPAERWDTAAIYdESAaET-GtTYSKVGAFLEHIDRFDAHYFGISA 89
gi 70730155  1035 VAVVAMACRFP-Q-ADSPEALWKLMLEQTDTVGPVPPSRL---------AgAKPEeTFPRFASLIQRPEGFDEAFFRISP 1103
gi 115360664   36 vavvgvSLRFP-GgVTDLDSYWALLREGRSGVIEVEPERWSNRQFV-DPDyAAAGkLVTPYAGLLEHIYDFDAEFFGLSA 113
gi 115360666   47 IAIVGVGCRLP-GgVAGPDDYWALLRSAGSGIVEMQDQRWNMAA-YfDADpEAGGrIHTRSLGLVDEVDRFDADFFSISP 124
gi 115360963   21 IAIIGMSCRFP-GgASCASSYWTLLNSGRTAIRETPRERFDIDAFYs-PDpAEPGtTYSRVAGYVDDPFCFDRGLFRTSA 98
gi 115360976   11 IAITGTAYRFP-GdAACHESYWALLESGRTAVRETPMARFDIQPFFsE-DaSVPGtTYVRNGGYVEGAFEFDAGFFRISE 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QO3_A         87 REAAAMDPQQRLLLETSWELVENAGIDPHSLRGTATGVFLGVAKFGY--GED--TAAA-----EDVEGYSVTGVAPAVAS 157
gi 154244957  124 REAASMDPQHRLLLEVAWEAVERAAWSPQALAGSSTGVFVGIYSDDYtqERL--YRRAa----DQIDGHAGLAMMRSLAA 197
gi 37223144    90 SEAREMDPQQRLLLEVAWECMERAGLCSERLKGSRTAVYVGMLGMDY--LTL--HAREag--iPAINPFYAAGKEFSFAA 163
gi 37223144  1099 REAGSMDPQQRLFLMVAWEALERAGIPPHDLRERQVGVFVGANAHDY--EAR--LLACa----AGIDANYGTGSAFSAIS 1170
gi 70730155    90 SEAKEMDPQQRLLLEVACESVARAGLTREQLKGSRTAVYVGMLGMDY--LAL--HSREag--iEQINPYYAAGKEFSFAA 163
gi 70730155  1104 KEARSMDPQQRLLLMVAWEALERAGIPQEKLLEQRVGVFVGANSHDY--ETR--VLGSa----QGVDAHYGTGSSFSAIC 1175
gi 115360664  114 LEAENLDPQQRLLLEQSWLALEDAGYDIGRLRGSDTGVVVGIGSQDY--GMA--LLADp----AHANPYVASGNSLSMAA 185
gi 115360666  125 REAESMDPQQRLLLEVAWEAIERSGHACASLDGRQVGVFVGMMNKDY--LHL--NAPDitgeaARHSPYYASGEAFSIAA 200
gi 115360963   99 AEAIEMDPQQRWMLELAWEALENAGFAPGQLRGKNVGVFMTTGEADY--GRRtvWSGDp----GKITTYSKLGNLRAMAP 172
gi 115360976   89 SEALAMDPQQRWMLELCWAALENAGIAPGTVRGQSIGVFLGSGEVDY--GRRtvWAGDm----SKLTTYARLGASRPTLA 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QO3_A        158 GRISYTMGLEGPSISVDTACSSSLVALHLAVESLRKGESSMAVVGGAAVMATPGVFVDFSRQRALAADGRSKAFGAGADG 237
gi 154244957  198 GRIAYALDLHGPAMALDAACASSLLAIHLACRSLRAGECDRALAGGVNLILSREITLGLCQMKALSPTGRCRTFSADADG 277
gi 37223144   164 GRIAYHLGVHGPAMAVSTACSSSLVAIHLGCRALQNREADLAIAAGVNLMLSPELTIYMSQIKAISPSGRCRVFDAAADG 243
gi 37223144  1171 GRLSHFLGLRGPSLTVDTACSSSLTAVHLACNSLLAGECEIAIVGGVNVIASSAIFQSMGDAGALSADGTCKTFDDRADG 1250
gi 70730155   164 GRIAYHLGVHGPAMTVTTACSSSLVAMHLACRALQAGEADMALAGGVNLMLAPDLTIYMSQIRAISPSGRCRVFDAAADG 243
gi 70730155  1176 GRLSHFLGVRGPSLTVDTACSSSLTAIHLACNSLRAAECDIAIVGGVNVIASASIFQSMGQAGALAPDGISKAFDDSADG 1255
gi 115360664  186 GRLSYFFDFSGPSLSIDTACSSSLVAVHEACRRLQLGECGLALAAGVNAMLTPHAGINFSRARMLSTERDCHTFDARAKG 265
gi 115360666  201 GRLAYILGVHGPCMTIDTACSSSLVAVHLACRSLLEDECELALAGGTSLILSPEASIVSSNARMLSPTGQCWSFDHRADG 280
gi 115360963  173 GRVAHILGLSGPAIFVDTTCSSSLVAIHLAAQSLQAGECDVAIAGGVNLILGPEETIGVARLQAMSVSGQCRPFDANADG 252
gi 115360976  163 GRVAYFLGVHGPAVFVDTACSSSLTAVHLAAQSLRAGDCDIAIAGGINLILSPEETILGARLQAMSPSEMCRPFDARADG 242
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QO3_A        238 FGFSEGVTLVLLERLSEARRNGHEVLAVVRGSALNQDGASNGLSAPSGPAQRRVIRQALESCGLEPGDVDAVEAHGTGTA 317
gi 154244957  278 FVRGEGCGVVALRRLDDAVRDGDPVLAVIRGSAVNHDGRSNGISAPNGTAQQAVIRAALADAGIPARSVGYVEAHGTGTM 357
gi 37223144   244 IVRGEGGGALLLKRLEDARADGDPILAVIRGSAINQDGESAGQTVPNANAQAAVVRAALDAAGLEIDDIAYVEAHGTGTP 323
gi 37223144  1251 YGRGEGCGVVILKRAERARADGDRVIAVLLGSAVNHDGACAGLTVPNGPAQEALIREALANASLSAAAVGYVEAHGTGTV 1330
gi 70730155   244 IVRGEGCGVTVLKRLADALRDGDPIQAVIRGSAINQDGASAGQTVPNANAQAAVISQALKVAGLSVDDIDYVEAHGTGTP 323
gi 70730155  1256 YGRGEGCGVVILKRQAQAERERDPIVATILGSAVNHDGACAGLTVPNGPAQEALISEALANAGVHPGQVSYVEAHGTGTV 1335
gi 115360664  266 YVRGEGCAVLVLKRLADAQADGDRIHAVIRGVAINHDGHSSGLTVPNGSAQRAVIRAALRRAGVAPAEVDYAEAHGTGTR 345
gi 115360666  281 YVRGEGCAVVVLKRLSRALADGDPVLAVIAGSAVNHDGRSQGLTAPNTAAQMALMREALRGAKLDAARIRYVEAHGTGTP 360
gi 115360963  253 YIRGEGGGALVMKRLGDARTHGDRIDAVLVGSAVNSDGASNGLTAPNGAAQEAVIRRAMARAGVRPEAVAYVEAHGTGTA 332
gi 115360976  243 YLRGEGGGVVVLKRIDDAVRDGDRIDAVLAGSAINNDGASNGLTAPNGAAQESAIRVALRRAGVGPASVAYVEAHGTGTQ 322
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QO3_A        318 LGDPIEANALLDTYGRDRDADRPLWLGSVKSNIGHTQAAAGVTGLLKVVLALRNGELPATLHVEEPTPHVDWSSGGVALL 397
gi 154244957  358 LGDPIELRALGAVYGAERAV--PLLVGSAKTNFGHLEAAAGVAGFLKVVLALRHGEVPPNLHFSAPNPYVPWDALGLAVP 435
gi 37223144   324 LGDPIELSSLAEVFRQ---RKKPLLVGSVKANMGHLDAAAGMASVIKTMQLLRHGEVPPQLHLVKPNALVDWQRSSLRVA 400
gi 37223144  1331 LGDPIELQALANAYRG--TERVPLAVASVKGNVGHLEAAAGIASLIKACLVVERGVIPGQAGFQRPNSRFDWQATSLQVP 1408
gi 70730155   324 LGDPIELSSLDSAFQG---RERPLWVGSVKANMGHLDAAAGMASVIKTMMVLKHAEVPAQLHLAQLNPLVDWKRSRLAVP 400
gi 70730155  1336 LGDPIELNALHNAYRQASPDSPPLTVASVKANIGHLEAAAGIASLIKACLVVEHGRIAPQAHLQRANTRVDWAAMNLKLA 1415
gi 115360664  346 LGDPIEAHAIADVYGEAREAGRPLVIGAVKANLGHLEAAAGLAGLIKAMLVVRHGEAPPQPGFETLNPAIGWDTAKFKVV 425
gi 115360666  361 LGDPIEMNSIQAVYGEARDEASPLVIGSVKTQIGHTEACAGVAGLIKLALCVAHDRVVPQRNFERLNPHITLRDG-VRLA 439
gi 115360963  333 LGDPIELSALRNVYARAVTRDKPILVGSVKSQLGHLEGAAGMAGFIKAMLILRHRQVPAQVNFATPNPRFHWEGAQLEIP 412
gi 115360976  323 LGDPIELTALRNAYTAGVERARPLLVGSVKAQIGHLEAGAGIAGLIKAMLILSRRRVPVQANFDDPTPRFRWDDSQICVP 402
                         410       420       430
                  ....*....|....*....|....*....|....*
2QO3_A        398 AGNQPWr-rGERTRRAAVSAFGISGTNAHVIVEEA 431
gi 154244957  436 TAPAAFp--aDGPMRGAVSAFGMSGTNAHVIleaa 468
gi 37223144   401 TSLETLp---eGPRLAGVSAFGLSGTNVHLILEGA 432
gi 37223144  1409 QANQPWe-vPAAERIAGISAFGFTGTNVHVLLrge 1442
gi 70730155   401 TAIESLp---DRPRLAGISGFGLSGTNVHMILEDA 432
gi 70730155  1416 HQAMDWp-gRPESRVAGVSAFGFTGTNVHVLLKGY 1449
gi 115360664  426 RQPTPLrpaDGRPWLAGVSSFGFSGTNAHaivaaa 460
gi 115360666  440 LRDEPFg-gEAGARYGAVNSFGFSGTNAHLIVRDL 473
gi 115360963  413 RDGMPL---GDGNAFVGVSGFGITGTNVHMILAEP 444
gi 115360976  403 RTGEDa---LDENGMVGVNGFGISGTNVHLVLAGA 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap