Conserved Protein Domain Family
H3

?
Click on image for an interactive view with Cn3D
Histone H3
Links
?
Statistics
?
PSSM-Id: 128705
View PSSM: smart00428
Aligned: 10 rows
Threshold Bit Score: 161.462
Threshold Setting Gi: 729678
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

smart00428 is a member of the superfamily cl23735.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3NQU_A        33 LGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRg-vDFNWQAQALLALQEAAEAFLVHLFEDAYL 111
gi 301789712  73 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT---DLRFQSSAVMALQEACEAYLVGLFEDTNL 149
gi 17553562  156 NRISKTRRYRPGQKALEEIRKYQESEDLLIPKAPFARLVREIMQTSTPfssDLRIRSDAINALQEASEALLVQMFDGSSL 235
gi 6680920    28 VGSQTLRR-RQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRg-vDFWWQAQALLALQEAAEAFLIHLFEDAYL 105
gi 17553736  183 NRVTKTRRYRPGQKALEEIRKYQKTEDLLIQKAPFARLVREIMQTSTPfgaDCRIRSDAISALQEAAEAFLVEMFEGSSL 262
gi 27808712  124 SLKRVEKKYTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTkdqDLRWQSMAIMALQEASEAYLVGLLEHTNL 203
gi 729678     28 GVKRSHRRWRPGTCAIREIRKFQKSTSLLIQCAPFQRLVR-GVERQKE---GLRFQSSAIMALQEATEAYIVSLMADTNL 103
gi 67471415   33 KDSTKKKRAHPGAVALTEIKVLQRSTELLLRKAPFQALVREIAQVSKS---DLRFQSAAISALQEAAEAYLVGLFEDTNL 109
gi 7505196    58 KSKTLCTLMYDRTVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKT---DLRFQSSAVMALQEAAEAYLVGLFEDTNL 134
3AFA_A        37 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT---DLRFQSSAVMALQEACEAYLVGLFEDTNL 113
                         90       100
                 ....*....|....*....|....*.
3NQU_A       112 LTLHAGRVTLFPKDVQLARRIRGLEE 137
gi 301789712 150 CAIHAKRVTIMPKDIQLARRIRGERA 175
gi 17553562  236 ISAHSKRATLTTTDVQLYRRLCLPNL 261
gi 6680920   106 LSLHAGRVTLFPKDIQLTRRIRGFEG 131
gi 17553736  263 ISTHAKRVTLMTTDIQLYRRLCLRHL 288
gi 27808712  204 LALHAKRITIMKKDMQLARRIRGQFI 229
gi 729678    104 ACIHAKRVTIQPKDIQLALRLRGERH 129
gi 67471415  110 CAIHAKRITIMPKDMQLARRIRGERT 135
gi 7505196   135 CAIHAKRVTIMPKDIQLARRIRGERA 160
3AFA_A       114 CAIHAKRVTIMPKDIQLARRIRGERA 139
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap