1K78


Conserved Protein Domain Family
PAX

?
smart00351: PAX 
Click on image for an interactive view with Cn3D
Paired Box domain
Statistics
?
PSSM-Id: 128645
View PSSM: smart00351
Aligned: 19 rows
Threshold Bit Score: 175.588
Threshold Setting Gi: 74965747
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1K78_A        16 GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGS-KPK-VATP 93
gi 74961980   13 GQGRVNQLGGVFINGRPLPIHVRHAIISMAKKGIKPCHISRQLKVSHGAVSKILNRYAETGSISPGQIGGSpRAR-LTVQ 91
gi 74964676   97 RSSGRNQLGRTYSPGLPLSMCEREEIVKLFQGGWKICDISKRLCVTHSCVSKILNRYRQTGSVKPK---DA-KEG-RTES 171
gi 5758941     2 SHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGS-KPR-VATP 79
gi 31563344   34 GQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGS-KPKqVTTP 112
gi 74137227    4 tYGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGS-KPR-VTTP 81
gi 71987648    5 GHTGVNQLGGVFVNGRPLPDATRQRIVDLAHKGCRPCDISRLLQVSNGCVSKILCRYYESGTIRPRAIGGS-KPR-VATS 82
gi 4185914    20 GHSGINQLGGIFVNGRPLPDVTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGS-KPR-VATN 97
gi 195586621  19 GQGRVNQLGGVFINGRPLPNHIRRQIVEMAAAGVRPCVISRQLRVSHGCVSKILNRFQETGSIRPGVIGGS-KPR-VATP 96
gi 6491915     5 GLSSVNQLGGLFVNGRPLPLDTRQQIVQLAIRGMRPCDISRSLKVSNGCVSKILGRYYRTGVLEPKCIGGS-KPR-LATP 82
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
1K78_A        94 KVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIR 140
gi 74961980   92 AVEKEILIACDENPQMSAAELRDWLIHKDICTKGNAPTVPAIKRLIG 138
gi 74964676  172 PLVLAVRDYRSRLGMCRQSEIREQLIRDGVCTRDNAPSRSSINHilr 218
gi 5758941    80 EVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLR 126
gi 31563344  113 DVEKKIEEYKRENPGMFSWEIRDKLLKDAVCDRNTVPSVSSISRILR 159
gi 74137227   82 NVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILR 128
gi 71987648   83 DVVEKIEDYKRDQPSIFAWEIRDKLLADNICNNETIPSVSSINRVLR 129
gi 4185914    98 TVVRKVTIYKQESPSMFAWEIRDRPLQDGVCNQDNLPSISSINRILR 144
gi 195586621  97 DIESRIEELKQSQPGIFSWEIRAKLIEAGVCDKQNAPSVSSISRLLR 143
gi 6491915    83 AVVARIAQLKDEYPALFAWEIQHQLCTEGLCTQDKAPSVSSINRVLR 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap