3GJ0


Conserved Protein Domain Family
RAN

?
smart00176: RAN 
Click on image for an interactive view with Cn3D
Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases
Ran is involved in the active transport of proteins through nuclear pores.
Statistics
?
PSSM-Id: 128473
View PSSM: smart00176
Aligned: 4 rows
Threshold Bit Score: 420.572
Threshold Setting Gi: 1668706
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3GJ0_A        21 VGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSR 100
gi 109099257  36 VGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSR 115
gi 17553976   15 VGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTAR 94
gi 1668706    19 VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTAR 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3GJ0_A       101 VTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLE 180
gi 109099257 116 VTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLE 195
gi 17553976   95 VTYKNVPNWHRDLARVCENIPIVLCGNKVDVKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLE 174
gi 1668706    99 LTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLH 178
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
3GJ0_A       181 FVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDD 220
gi 109099257 196 FVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDD 235
gi 17553976  175 FVAMPALAPPEVQMDPAMIAEYEKDLDNAAKAdlpddddd 214
gi 1668706   179 FVESPALAPPEVHLDIAAQPKNEADLAAAAAQPLPDDDDD 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap