Conserved Protein Domain Family

smart00167: VPS9 
Domain present in VPS9
Domain present in yeast vacuolar sorting protein 9 and other proteins.
PSSM-Id: 128469
Aligned: 6 rows
Threshold Bit Score: 141.439
Threshold Setting Gi: 323346211
Created: 12-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAY81723   282 PDFIRGEEEYYLSSLQAALNFIMSLTERSLTIDDHEDFEE 321  Saccharomyces cerevisiae EC1118
EGA80501   384 KKKLVETESFALTNLEAALVFVEGLTKNDfsnelqdkltv 423  Saccharomyces cerevisiae Lalvin QA23
NP_508208 1068 DRIESGRDAYYWVNFKSAVEYIKTIL-------------- 1093 nematode
CAY81723   282 PDFIRGEEEYYLSSLQAALNFIMSLTERSLTIDDHEDFEE 321  Saccharomyces cerevisiae EC1118
EGA80501   384 KKKLVETESFALTNLEAALVFVEGLTKNDfsnelqdkltv 423  Saccharomyces cerevisiae Lalvin QA23
NP_508208 1068 DRIESGRDAYYWVNFKSAVEYIKTIL-------------- 1093 nematode
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap