Conserved Protein Domain Family
SAPA

?
smart00162: SAPA 
Saposin/surfactant protein-B A-type DOMAIN
Present as four and three degenerate copies, respectively, in prosaposin and surfactant protein B. Single copies in acid sphingomyelinase, NK-lysin amoebapores and granulysin. Putative phospholipid membrane binding domains.
Statistics
?
PSSM-Id: 128465
View PSSM: smart00162
Aligned: 6 rows
Threshold Bit Score: 64.0753
Threshold Setting Gi: 165708
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....
gi 18201959   22 WQKDCAKGPEVWCQSLRTASQCGAVKHCQQNVWS 55
gi 74763408  172 GKSRCTWGPSYWCSNFSTGRECNATPHCINRVWS 205
gi 148700230 474 GTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN 507
gi 149038761  14 DPKICSGGSAVVCRDVKTAVDCRAVKHCQQMVWS 47
gi 332834342  21 GLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWN 54
gi 165708     29 SPLACAQGPEFWCQSLEQALQCKALGHCLQEVWG 62
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap