
Conserved Protein Domain Family

cd02742: GH20_hexosaminidase 
Click on image for an interactive view with Cn3D
Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
PSSM-Id: 119331
Aligned: 11 rows
Threshold Bit Score: 309.365
Created: 13-Dec-2003
Updated: 2-Oct-2020
Aligned Rows:
active site
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
  • Structure:1YHT_A; Aggregatibacter actinomycetemcomitans dispersin B binds glycerol and acetic acid.
    View structure with Cn3D
  • Structure:1NP0_A; Homo sapiens Lysosomal Beta-Hexosaminidase isoform B (HexB) beta subunit, binds an intermediate analog NAG-Thiazoline (N-acetyl-beta-D-glucosamine-thiazoline).
    View structure with Cn3D
  • Structure:1C7T_A; Serratia marcescens chitobiase binds Di- N Acetyl-D-Glucosamine, contacts at 4A.
    View structure with Cn3D
  • Structure:1M01_A; Streptomyces plicatus Beta-hexosaminidase bound with product (GlcNAc), contacts at 3.5A. N-acetyl-D-glucosamine
    View structure with Cn3D
  • Comment:For 1M01_A, the most C-terminal active site Asp residue plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state.
  • Structure:2GK1_A/B; Homo sapiens Lysosomal Beta-Hexosaminidase isoform A (HexA), alpha and beta subunits each bind an intermediate analog NAG-Thiazoline (N-acetyl-beta-D-glucosamine-thiazoline), contacts at 4 A.
    View structure with Cn3D
  • Comment:there are two active sites in the HexA heterodimer, one in the alpha subunit, one in the beta subunit. A Tyr residue from the beta subunit is found in the active site of the alpha subunit and vice versa.

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                 #                                                                      
1M01_A       159 WRSAMLDVSR-HFFGVDEVKRYIDRVARYKYNKLHLHLsddqgwRIAIDSWprlatyggs---------------tevgg 222 Streptomyces pl...
1NP0_B       153 HRGILIDTSR-HYLPVKIILKTLDAMAFNKFNVLHWHIvddqsfPYQSITFpelsnkg--------------------sy 211 human
1C7T_A       313 YRGIFLDVAR-NFHKKDAVLRLLDQMAAYKLNKFHFHLsddegwRIEIPGLpeltevggqrchdlsettcllpqygqgpd 391 Serratia marces...
2EPL_X        86 DLAYMADCSRnAVLNLSSAKKMIEVLALMGYSTFELYMe----dTYEIENQpyfg------------------------- 136 Streptococcus g...
1YHT_A        18 QTGLMLDIAR-HFYSPEVIKSFIDTISLSGGNFLHLHFsdhenyAIESHLLnqraenavqgkd----------giyinpy 86  Aggregatibacter...
YP_001878518 126 IRCFMHDAGR-HFRTVETLKADIDEMARLKINAFHWHLtdypawRIQCKKYpvlndpskr----------------iqgr 188 Akkermansia muc...
YP_001877017 170 LRGIMLDVGR-YYMSPALIKEVMRRLSRYKINTLHLHLtddpawRLEVKKYpaltdgafh----------------wksr 232 Akkermansia muc...
NP_809369    147 IRGFMQDVGR-SYLSLEELKREIAILSRFKINTFHWHLtenqawRLESKIFpmlndstn------------------mtr 207 Bacteroides the...
YP_129481    168 WRGALIDTSR-HFIPVDVIKRQIDGLASAKFNTFHWHLtddqgwRIESLAYpnlhek----------------------g 224 Photobacterium ...
2GK1_A       147 HRGLLLDTSR-HYLPLSSILDTLDVMAYNKLNVFHWHLvddpsfPYESFTFpelmrkg-------------------syn 206 human
2GK1_B       153 HRGILIDTSR-HYLPVKIILKTLDAMAFNKFNVLHWHIvddqsfPYQSITFpelsnkg--------------------sy 211 human
Feature 1                                         #                                              
1M01_A       223 gpggYYTKAEYKEIVRYAASRHLEVVPEIDMPGHTNAALAsyaelncdgvap-------------------plytgtkvg 283 Streptomyces pl...
1NP0_B       212 slshVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGKgqkdlltpcys----------------------rqnklds 269 human
1C7T_A       392 vyggFFSRQDYIDIIKYAQARQIEVIPEIDMPAHARAAVVsmearykklhaagkeqeanefrlvdqtdtsnttsvqffnr 471 Serratia marces...
2EPL_X       137 yfrgRYTVAELQEIEDYAADFDMSFVPCIQTLAHLSAFVKwgikevqe----------------------------lrdv 188 Streptococcus g...
1YHT_A        87 tgkpFLSYRQLDDIKAYAKAKGIELIPELDSPNHMTAIFKlvqkdrgvkyl---------------------qglksrqv 145 Aggregatibacter...
YP_001878518 189 dvngTYSYDQIRDLFRYARERHVQIIPEIDMPGHSTYFKNcf-------------------------------------- 230 Akkermansia muc...
YP_001877017 233 lpgrFYTQAQLKDLTDYCARLNIQVIPEIDMPGHSQPFARam-------------------------------------- 274 Akkermansia muc...
NP_809369    208 magkYYTLEEARELTEFCKAHQVLLIPEIDMPGHSAAFIRtf-------------------------------------- 249 Bacteroides the...
YP_129481    225 sdglYYTREQMKDVVAYAKNLGIRVIPEVDLPGHASAIAAaypelmtevkey-------------------kierkwgvh 285 Photobacterium ...
2GK1_A       207 pvthIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPgipglltpcys----------------------gsepsgt 264 human
2GK1_B       212 slshVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGKgqkdlltpcys----------------------rqnklds 269 human
Feature 1                                                ##                                      
1M01_A       284 fssLCVDKDVTYDFVDDVIGELAAlt-----pgRYLHIGGDEahs----------------------------------- 323 Streptomyces pl...
1NP0_B       270 fgpINPTLNTTYSFLTTFFKEISEvf-----pdQFIHLGGDEvefkcwesnpkiq------------------------- 319 human
1C7T_A       472 qsyLNPCLDSSQRFVDKVIGEIAQmhkeagqpiKTWHFGGDDaknirlgagytdkakpepgkgiidqsnedkpwaksqvc 551 Serratia marces...
2EPL_X       189 ediLLIGEEKVYDLIEGMFQTMAHlh------tRKINIGMDEahlvglgry----------------------------- 233 Streptococcus g...
1YHT_A       146 ddeIDITNADSITFMQSLMSEVIDifg---dtsQHFHIGGDEfgys---------------------------------- 188 Aggregatibacter...
YP_001878518 231 --gFPMHDPRGINILEELLEEFCReipa--emsPYLHIGADEi------------------------------------- 269 Akkermansia muc...
YP_001877017 275 --kTGMQTEKGVSILKDVVDEAVSlf-----pgRFFHMGSDEa------------------------------------- 310 Akkermansia muc...
NP_809369    250 --rHDMQSPEGMKILKLLLDEICEtf-----dvPYLHIGTDEv------------------------------------- 285 Bacteroides the...
YP_129481    286 eplLDPTKPEVYTFIDKIIGEVAElf-----pdEYIHIGGDEvnpkqwneskav-------------------------- 334 Photobacterium ...
2GK1_A       265 fgpVNPSLNNTYEFMSTFFLEVSSvf-----pdFYLHLGGDEvdftcwksnpeiq------------------------- 314 human
2GK1_B       270 fgpINPTLNTTYSFLTTFFKEISEvf-----pdQFIHLGGDEvefkcwesnpkiq------------------------- 319 human
Feature 1                                             #                                       #  
1M01_A       324 ----------tpKADFVAFMKRVQPIVAKyg-kTVVGWHQlagae-----------------------pvegALVQYWgl 369 Streptomyces pl...
1NP0_B       320 dfmrqkgfgtdfKKLESFYIQKVLDIIATin-kGSIVWQEvfddka---------------------klapgTIVEVWkd 377 human
1C7T_A       552 qtmikegkvadmEHLPSYFGQEVSKLVKAhgidRMQAWQDglkdaess-----------------kafatsrVGVNFWdt 614 Serratia marces...
2EPL_X       234 ---likhgfqnrSLLMCQHLERVLDIADKyg-fNCQMWSDmffklmsadgqydrdveipeetrvyldrlkerVTLVYWdy 309 Streptococcus g...
1YHT_A       189 ---------vesNHEFITYANKLSYFLEKkg-lKTRMWNDglikntf-------------------eqinpnIEITYWsy 239 Aggregatibacter...
YP_001878518 270 -----------rIPNGKQFADRMAAKVKSlg-rQPIQWAGnndlp-----------------------vsgdSYAQLWnd 314 Akkermansia muc...
YP_001877017 311 ------------HISMKDFIPRMAEHIRGkg-kEVVVWSPggph-------------------------dkdSVLMCWge 352 Akkermansia muc...
NP_809369    286 ------------HFTNPQFVPEMVAYVRDkg-kKVISWNPgwkyk-----------------------ageiDMMQLWsy 329 Bacteroides the...
YP_129481    335 qtfmaekglkdaLELHAFFNQEVEEILKKhd-rKMIGWDEtyhpd-----------------------lpksIVIQSWrg 390 Photobacterium ...
2GK1_A       315 dfmrkkgfgedfKQLESFYIQTLLDIVSSyg-kGYVVWQEvfdnkv---------------------kiqpdTIIQVWre 372 human
2GK1_B       320 dfmrqkgfgtdfKKLESFYIQKVLDIIATin-kGSIVWQEvfddka---------------------klapgTIVEVWkd 377 human
Feature 1                                                                                        
1M01_A       370 drtg---------daekaeVAEAARNGTGLILSpadrtyldmkytk--dtplglswagyveVQRSYDwdpagyl------ 432 Streptomyces pl...
1NP0_B       378 sa-------------ypeeLSRVTASGFPVILSapwyldl---------------isygqdWRKYYKvepldfgg----- 424 human
1C7T_A       615 lyw-----------ggfdsVNDWANKGYEVVVSnpdyvymdfpyevnpdergyywgtrfsdERKVFSfapdnmpqnaets 683 Serratia marces...
2EPL_X       310 yqdse--------ekynrnFQNHHKISQDIAFAggawkwig-------------ftphnhfSRLVAIeanka-------- 360 Streptococcus g...
1YHT_A       240 dgdtqdkneaaerrdmrvsLPELLAKGFTVLNYnsyylyivpka------sptfsqdaafaAKDVIKnwdlgvwdgrn-- 311 Aggregatibacter...
YP_001878518 315 en--------------svgLPDPARQKNPYFDStagyvns--------------fdpgilvRRNFFRqpcgta------- 359 Akkermansia muc...
YP_001877017 353 -----------------neAGARMDKNMKRIDSngfyidw---------------adsqsgVYQVFFqqpcev------- 393 Akkermansia muc...
NP_809369    330 rg-------------kaqqGIPAIDSRFHYLNHfdtfgd-----------------iialyNSRIYNadmg--------- 370 Bacteroides the...
YP_129481    391 h----------------dsLGESANDGYQGILStgyyi------------------dqaqpAAMHYRndpmpkplqvdde 436 Photobacterium ...
2GK1_A       373 dipv----------nymkeLELVTKAGFRALLSapwylnr---------------isygpdWKDFYVveplafeg----- 422 human
2GK1_B       378 sa-------------ypeeLSRVTASGFPVILSapwyldl---------------isygqdWRKYYKvepldfgg----- 424 human
Feature 1                                                                                        
1M01_A           --------------------------------------------------------------------------------     Streptomyces pl...
1NP0_B           --------------------------------------------------------------------------------     human
1C7T_A       684 vdr----------------------------------------------------------------------------- 686 Serratia marces...
2EPL_X           --------------------------------------------------------------------------------     Streptococcus g...
1YHT_A           --------------------------------------------------------------------------------     Aggregatibacter...
YP_001878518     --------------------------------------------------------------------------------     Akkermansia muc...
YP_001877017     --------------------------------------------------------------------------------     Akkermansia muc...
NP_809369        --------------------------------------------------------------------------------     Bacteroides the...
YP_129481    437 vhtdeswetwqfeaprkrgsavtgtftlitakdgtrrgfidyksrsrravfdiettqgitsfwmdswmgqtkprvelqgg 516 Photobacterium ...
2GK1_A           --------------------------------------------------------------------------------     human
2GK1_B           --------------------------------------------------------------------------------     human
Feature 1                                                              # #                       
1M01_A       433 ---------------------------------------pgapadaVRGVEAPLWTEtlsdpd---qldymAFPRLPGVA 470 Streptomyces pl...
1NP0_B       425 ---------------------------------------tqkqkqlFIGGEACLWGEyvdat----nltprLWPRASAVG 461 human
1C7T_A       687 -------------------------------dgnhfnaksdkpwpgAYGLSAQLWSEtqrtdp---qmeymIFPRALSVA 732 Serratia marces...
2EPL_X       361 -----------------------------------------crknqVKEVIVTGWGDngget-----sqfsVLPALQIWA 394 Streptococcus g...
1YHT_A       312 ------------------------------------tknrvqntheIAGAALSIWGEdakalkd-etiqknTKSLLEAVI 354 Aggregatibacter...
YP_001878518 360 -----------------------------------------rgnnhSLGVIQCLWPDtrvenkknipvqspQWPAMFAMA 398 Akkermansia muc...
YP_001877017 394 ----------------------------------------pqgddkALGAIMPVWCDgnlsserrvleqypFYPCALTFA 433 Akkermansia muc...
NP_809369    371 -------------------------------------------sddLAGVIMGIWNDrlidkewnmvlennFYPNMLAIA 407 Bacteroides the...
YP_129481    517 kltghmvvgnaqyvmtgqkiagndiqnsqyptapypvalkkeqehlILGGEVTLWAEnvkdd----tidlrMWPRSYVIA 592 Photobacterium ...
2GK1_A       423 ---------------------------------------tpeqkalVIGGEACMWGEyvdnt----nlvprLWPRAGAVA 459 human
2GK1_B       425 ---------------------------------------tqkqkqlFIGGEACLWGEyvdat----nltprLWPRASAVG 461 human
Feature 1             
1M01_A       471 ELGWS 475 Streptomyces plicatus
1NP0_B       462 ERLWS 466 human
1C7T_A       733 ERSWH 737 Serratia marcescens
2EPL_X       395 ELAYR 399 Streptococcus gordonii
1YHT_A       355 HKTNG 359 Aggregatibacter actinomycetemcomitans
YP_001878518 399 ERSWK 403 Akkermansia muciniphila ATCC BAA-835
YP_001877017 434 ERVWR 438 Akkermansia muciniphila ATCC BAA-835
NP_809369    408 ERSWR 412 Bacteroides thetaiotaomicron VPI-5482
YP_129481    593 ERLWS 597 Photobacterium profundum SS9
2GK1_A       460 ERLWS 464 human
2GK1_B       462 ERLWS 466 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap